From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002631000
  • symbol?: nrdF
  • description?: ribonucleotide-diphosphate reductase subunit beta

      descriptions from strain specific annotations:

    • ribonucleotide-diphosphate reductase subunit beta
    • Ribonucleotide reductase of class Ib (aerobic), beta subunit
    • ribonucleoside-diphosphate reductase, beta subunit
    • Ribonucleoside-diphosphate reductase class Ib beta subunit
    • ribonucleoside-diphosphate reductase subunit beta
    • ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit)
    • ribonucleotide reductase, small chain family protein
  • strand?: +
  • coordinates?: 3135443..3136447
  • synteny block?: BlockID0018660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0793 (nrdF)
    N315:
    SA0687 (nrdF)
    NCTC8325:
    Newman:
    NWMN_0701 (nrdF)
    USA300_FPR3757:
    04-02981:
    SA2981_0710
    08BA02176:
    C248_0819 (rir2)
    11819-97:
    MS7_0783
    71193:
    ST398NM01_0809
    ECT-R 2:
    ECTR2_682
    ED133:
    SAOV_0768 (nrdF)
    ED98:
    SAAV_0694 (nrdF)
    HO 5096 0412:
    SAEMRSA15_06580 (rir2)
    JH1:
    SaurJH1_0773 (nrdF)
    JH9:
    SaurJH9_0756 (nrdF)
    JKD6008:
    SAA6008_00747 (nrdF)
    JKD6159:
    SAA6159_00687 (nrdF)
    LGA251:
    SARLGA251_06650 (rir2)
    M013:
    M013TW_0718
    MRSA252:
    SAR0786 (nrdF)
    MSHR1132:
    SAMSHR1132_06770
    MSSA476:
    SAS0697 (nrdF)
    Mu3:
    SAHV_0729 (nrdF)
    Mu50:
    SAV0732 (nrdF)
    MW2:
    MW0694 (nrdF)
    RF122:
    SAB0683 (nrdF)
    ST398:
    SAPIG0809
    T0131:
    SAT0131_00802
    TCH60:
    HMPREF0772_12452 (nrdF)
    TW20:
    SATW20_08070 (rir2)
    USA300_TCH1516:
    USA300HOU_0756 (nrdF)
    VC40:
    SAVC_03295 (nrdF)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIAVNWNTQEDMTNMFWRQNISQMWVETEFKVSKDIASWKTLSEAEQDTFKKALAGLTGL
    N315            MIAVNWNTQEDMTNMFWRQNISQMWVETEFKVSKDIASWKTLSEAEQDTFKKALAGLTGL
    NCTC8325        MIAVNWNTQEDMTNMFWRQNISQMWVETEFKVSKDIASWKTLSEAEQDTFKKALAGLTGL
    Newman          MIAVNWNTQEDMTNMFWRQNISQMWVETEFKVSKDIASWKTLSEAEQDTFKKALAGLTGL
    USA300_FPR3757  MIAVNWNTQEDMTNMFWRQNISQMWVETEFKVSKDIASWKTLSEAEQDTFKKALAGLTGL
                    ************************************************************

    COL             DTHQADDGMPLVMLHTTDLRKKAVYSFMAMMEQIHAKSYSHIFTTLLPSSETNYLLDEWV
    N315            DTHQADDGMPLVMLHTTDLRKKAVYSFMAMMEQIHAKSYSHIFTTLLPSSETNYLLDEWV
    NCTC8325        DTHQADDGMPLVMLHTTDLRKKAVYSFMAMMEQIHAKSYSHIFTTLLPSSETNYLLDEWV
    Newman          DTHQADDGMPLVMLHTTDLRKKAVYSFMAMMEQIHAKSYSHIFTTLLPSSETNYLLDEWV
    USA300_FPR3757  DTHQADDGMPLVMLHTTDLRKKAVYSFMAMMEQIHAKSYSHIFTTLLPSSETNYLLDEWV
                    ************************************************************

    COL             LEEPHLKYKSDKIVANYHKLWGKEASIYDQYMARVTSVFLETFLFFSGFYYPLYLAGQGK
    N315            LEEPHLKYKSDKIVANYHKLWGKEASIYDQYMARVTSVFLETFLFFSGFYYPLYLAGQGK
    NCTC8325        LEEPHLKYKSDKIVANYHKLWGKEASIYDQYMARVTSVFLETFLFFSGFYYPLYLAGQGK
    Newman          LEEPHLKYKSDKIVANYHKLWGKEASIYDQYMARVTSVFLETFLFFSGFYYPLYLAGQGK
    USA300_FPR3757  LEEPHLKYKSDKIVANYHKLWGKEASIYDQYMARVTSVFLETFLFFSGFYYPLYLAGQGK
                    ************************************************************

    COL             MTTSGEIIRKILLDESIHGVFTGLDAQHLRNELSESEKQKADQEMYKLLNDLYLNEESYT
    N315            MTTSGEIIRKILLDESIHGVFTGLDAQHLRNELSESEKQKADQEMYKLLNDLYLNEESYT
    NCTC8325        MTTSGEIIRKILLDESIHGVFTGLDAQHLRNELSESEKQKADQEMYKLLNDLYLNEESYT
    Newman          MTTSGEIIRKILLDESIHGVFTGLDAQHLRNELSESEKQKADQEMYKLLNDLYLNEESYT
    USA300_FPR3757  MTTSGEIIRKILLDESIHGVFTGLDAQHLRNELSESEKQKADQEMYKLLNDLYLNEESYT
                    ************************************************************

    COL             KMLYDDLGITEDVLNYVKYNGNKALSNLGFEPYFEEREFNPIIENALDTTTKNHDFFSVK
    N315            KMLYDDLGITEDVLNYVKYNGNKALSNLGFEPYFEEREFNPIIENALDTTTKNHDFFSVK
    NCTC8325        KMLYDDLGITEDVLNYVKYNGNKALSNLGFEPYFEEREFNPIIENALDTTTKNHDFFSVK
    Newman          KMLYDDLGITEDVLNYVKYNGNKALSNLGFEPYFEEREFNPIIENALDTTTKNHDFFSVK
    USA300_FPR3757  KMLYDDLGITEDVLNYVKYNGNKALSNLGFEPYFEEREFNPIIENALDTTTKNHDFFSVK
                    ************************************************************

    COL             GDGYVLALNVEALQDDDFVFDNK
    N315            GDGYVLALNVEALQDDDFVFDNK
    NCTC8325        GDGYVLALNVEALQDDDFVFDNK
    Newman          GDGYVLALNVEALQDDDFVFDNK
    USA300_FPR3757  GDGYVLALNVEALQDDDFVFDNK
                    ***********************