From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002636000
  • symbol?: sstA
  • description?: iron ABC transporter permease

      descriptions from strain specific annotations:

    • iron ABC transporter permease
    • iron compound ABC transporter permease
    • ferrichrome ABC transporter permease
    • transport system permease protein
    • enterochelin uptake permease
    • FecCD family ferrichrome transporter permease
    • FecCD transport family protein
    • iron (Fe+3) ABC superfamily ATP binding cassette transporter, membrane protein
    • iron (Fe+3) ABC transporter membrane protein
    • iron compound ABC transporter, permease protein
    • Iron compound ABC uptake transporter permease protein
    • ttg start
  • strand?: +
  • coordinates?: 3137416..3137967
  • synteny block?: BlockID0018710
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0711
    08BA02176:
    11819-97:
    MS7_0784 (ceuB)
    71193:
    ECT-R 2:
    ECTR2_683
    ED133:
    SAOV_0770
    ED98:
    SAAV_0695
    HO 5096 0412:
    JH1:
    SaurJH1_0774
    JH9:
    SaurJH9_0757
    JKD6008:
    SAA6008_00748 (sstA)
    JKD6159:
    SAA6159_00689 (sstA)
    LGA251:
    SARLGA251_06660 (sstA)
    M013:
    M013TW_0719
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0698
    Mu3:
    SAHV_0730
    Mu50:
    SAV0733
    MW2:
    MW0695
    RF122:
    SAB0685 (sstA)
    ST398:
    T0131:
    SAT0131_00805
    TCH60:
    TW20:
    SATW20_08080 (sstA)
    USA300_TCH1516:
    USA300HOU_0759
    VC40:
    SAVC_03300

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKYLLKGNILLLLLILLTIISLFIGVSELSIKDLLHLTESQRNILFSSRIPRTMSILIAG
    N315            MKYLLKGNILLLLLILLTIISLFIGVSELSIKDLLHLTESQRNILFSSRIPRTMSILIAG
    NCTC8325        MKYLLKGNILLLLLILLTIISLFIGVSELSIKDLLHLTESQRNILFSSRIPRTMSILIAG
    Newman          MKYLLKGNILLLLLILLTIISLFIGVSELSIKDLLHLTESQRNILFSSRIPRTMSILIAG
    USA300_FPR3757  MKYLLKGNILLLLLILLTIISLFIGVSELSIKDLLHLTESQRNILFSSRIPRTMSILIAG
                    ************************************************************

    COL             SSLALAGLIMQQMMQNKFVSPTTAGTMEWAKLGILIALLFFPTGHILLKLVFAVICSICG
    N315            SSLALAGLIMQQMMQNKFVSPTTAGTMEWAKLGILIALLFFPTGHILLKLVFAVICSICG
    NCTC8325        SSLALAGLIMQQMMQNKFVSPTTAGTMEWAKLGILIALLFFPTGHILLKLVFAVICSICG
    Newman          SSLALAGLIMQQMMQNKFVSPTTAGTMEWAKLGILIALLFFPTGHILLKLVFAVICSICG
    USA300_FPR3757  SSLALAGLIMQQMMQNKFVSPTTAGTMEWAKLGILIALLFFPTGHILLKLVFAVICSICG
                    ************************************************************

    COL             TFLFVKIIDFIKVKDVIFVPLLGIMMGGIVASFTTFISLRTNAVQSIGNWLNGNFAIITS
    N315            TFLFVKIIDFIKVKDVIFVPLLGIMMGGIVASFTTFISLRTNAVQSIGNWLNGNFAIITS
    NCTC8325        TFLFVKIIDFIKVKDVIFVPLLGIMMGGIVASFTTFISLRTNAVQSIGNWLNGNFAIITS
    Newman          TFLFVKIIDFIKVKDVIFVPLLGIMMGGIVASFTTFISLRTNAVQSIGNWLNGNFAIITS
    USA300_FPR3757  TFLFVKIIDFIKVKDVIFVPLLGIMMGGIVASFTTFISLRTNAVQSIGNWLNGNFAIITS
                    ************************************************************

    COL             GRYEILYLSIPLLALTYLFANHFTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVV
    N315            GRYEILYLSIPLLALTYLFANHFTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVV
    NCTC8325        GRYEILYLSIPLLALTYLFANHFTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVV
    Newman          GRYEILYLSIPLLALTYLFANHFTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVV
    USA300_FPR3757  GRYEILYLSIPLLALTYLFANHFTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVV
                    ************************************************************

    COL             TVGTLPFLGLVIPNIISIYRGDHLKNAIPHTMMLGAIFVLFSDIVGRIVVYPYEINIGLT
    N315            TVGTLPFLGLVIPNIISIYRGDHLKNAIPHTMMLGAIFVLFSDIVGRIVVYPYEINIGLT
    NCTC8325        TVGTLPFLGLVIPNIISIYRGDHLKNAIPHTMMLGAIFVLFSDIVGRIVVYPYEINIGLT
    Newman          TVGTLPFLGLVIPNIISIYRGDHLKNAIPHTMMLGAIFVLFSDIVGRIVVYPYEINIGLT
    USA300_FPR3757  TVGTLPFLGLVIPNIISIYRGDHLKNAIPHTMMLGAIFVLFSDIVGRIVVYPYEINIGLT
                    ************************************************************

    COL             IGVFGTIIFLILLMKGRKNYAQQ
    N315            IGVFGTIIFLILLMKGRKNYAQQ
    NCTC8325        IGVFGTIIFLILLMKGRKNYAQQ
    Newman          IGVFGTIIFLILLMKGRKNYAQQ
    USA300_FPR3757  IGVFGTIIFLILLMKGRKNYAQQ
                    ***********************