From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002639000
  • symbol?: sstC
  • description?: iron ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • iron ABC transporter ATP-binding protein
    • iron compound ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein
    • putative iron compound ABC transporter ATP-binding protein
    • Iron compound ABC uptake transporter ATP-binding protein
    • ABC transporter family protein
    • ferric anguibactin transport ATP-binding protein
    • ferrichrome ABC transporter ATP-binding protein
    • ferrichrome transport ATP-binding protein FhuC
    • iron (Fe+3) ABC superfamily ATP binding cassette transporter, ABC protein
    • iron (Fe+3) ABC transporter ATP-binding protein
    • iron compound ABC transporter, ATP-binding protein, putative
    • pseudogene
  • strand?: +
  • coordinates?: 3139370..3140131
  • synteny block?: BlockID0018740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0713
    08BA02176:
    C248_0822 (sstC)
    11819-97:
    MS7_0786
    71193:
    ST398NM01_0812
    ECT-R 2:
    ECTR2_686
    ED133:
    SAOV_0772
    ED98:
    SAAV_0697
    HO 5096 0412:
    SAEMRSA15_06610 (sstC)
    JH1:
    SaurJH1_0776
    JH9:
    SaurJH9_0759
    JKD6008:
    SAA6008_00750 (sstC)
    JKD6159:
    SAA6159_00691 (sstC)
    LGA251:
    SARLGA251_06680 (sstC)
    M013:
    M013TW_0721
    MRSA252:
    SAR0789 (sstC)
    MSHR1132:
    SAMSHR1132_06800
    MSSA476:
    SAS0700
    Mu3:
    SAHV_0732
    Mu50:
    SAV0735
    MW2:
    MW0697
    RF122:
    SAB0687 (sstC)
    ST398:
    SAPIG0812
    T0131:
    SAT0131_00807
    TCH60:
    HMPREF0772_12449 (sstC)
    TW20:
    SATW20_08100 (sstC)
    USA300_TCH1516:
    USA300HOU_0761
    VC40:
    SAVC_03310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIQVENLTKTINNQMILEDISIDIEKGKLTSLIGPNGAGKSTLLSAICRLIRFENGEVKI
    N315            MIQVENLTKTINNQMILEDISIDIEKGKLTSLIGPNGAGKSTLLSAICRLIRFDNGEVKI
    NCTC8325        MIQVENLTKTINNQMILEDISIDIEKGKLTSLIGPNGAGKSTLLSAICRLIRFENGEVKI
    Newman          MIQVENLTKTINNQMILEDISIDIEKGKLTSLIGPNGAGKSTLLSAICRLIRFENGEVKI
    USA300_FPR3757  MIQVENLTKTINNQMILEDISIDIEKGKLTSLIGPNGAGKSTLLSAICRLIRFENGEVKI
                    *****************************************************:******

    COL             DGQLMSDYKNNDLSKKISILKQTNHTEMNITVEQLVNFGRFPYSKGRLTKEDHDIVNDAL
    N315            DGQLMSDYKNNDLSKKISILKQTNHTEMNITVEQLVNFGRFPYSKGRLTKEDHDIVNDAL
    NCTC8325        DGQLMSDYKNNDLSKKISILKQTNHTEMNITVEQLVNFGRFPYSKGRLTKEDHDIVNDAL
    Newman          DGQLMSDYKNNDLSKKISILKQTNHTEMNITVEQLVNFGRFPYSKGRLTKEDHDIVNDAL
    USA300_FPR3757  DGQLMSDYKNNDLSKKISILKQTNHTEMNITVEQLVNFGRFPYSKGRLTKEDHDIVNDAL
                    ************************************************************

    COL             DLLQLQDIRNRNIKSLSGGQRQRAYIAMTIAQDTEYILLDEPLNNLDMKHAVQIMQTLKM
    N315            DLLQLQDIRNRNIKSLSGGQRQRAYIAMTIAQDTEYILLDEPLNNLDMKHAVQIMQTLKM
    NCTC8325        DLLQLQDIRNRNIKSLSGGQRQRAYIAMTIAQDTEYILLDEPLNNLDMKHAVQIMQTLKM
    Newman          DLLQLQDIRNRNIKSLSGGQRQRAYIAMTIAQDTEYILLDEPLNNLDMKHAVQIMQTLKM
    USA300_FPR3757  DLLQLQDIRNRNIKSLSGGQRQRAYIAMTIAQDTEYILLDEPLNNLDMKHAVQIMQTLKM
                    ************************************************************

    COL             LAHKMNKAIVIVLHDINFASCYSDQIVALKNGQLVKSDLKDNVIQSSVLSDLYDMNIQIE
    N315            LAHKMNKAIVIVLHDINFASCYSDQIVALKNGQLVKSDLKDNVIQSSVLSDLYDMNIQIE
    NCTC8325        LAHKMNKAIVIVLHDINFASCYSDQIVALKNGQLVKSDLKDNVIQSSVLSDLYDMNIQIE
    Newman          LAHKMNKAIVIVLHDINFASCYSDQIVALKNGQLVKSDLKDNVIQSSVLSDLYDMNIQIE
    USA300_FPR3757  LAHKMNKAIVIVLHDINFASCYSDQIVALKNGQLVKSDLKDNVIQSSVLSDLYDMNIQIE
                    ************************************************************

    COL             HIRNQRICLYFKD
    N315            HIRNQRICLYFKD
    NCTC8325        HIRNQRICLYFKD
    Newman          HIRNQRICLYFKD
    USA300_FPR3757  HIRNQRICLYFKD
                    *************