From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002641000
  • symbol?:
  • description?: CHY zinc finger superfamily protein

      descriptions from strain specific annotations:

    • CHY zinc finger superfamily protein
    • Zinc finger, CHY domain protein
    • zinc finger CHY domain-containing protein
    • Zinc finger protein
  • strand?: -
  • coordinates?: 3141669..3141983
  • synteny block?: BlockID0018760
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0715
    08BA02176:
    C248_0824
    11819-97:
    71193:
    ST398NM01_2840
    ECT-R 2:
    ED133:
    SAOV_0774c
    ED98:
    SAAV_0699
    HO 5096 0412:
    SAEMRSA15_06630
    JH1:
    SaurJH1_0778
    JH9:
    SaurJH9_0761
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_06700
    M013:
    MRSA252:
    SAR0791
    MSHR1132:
    SAMSHR1132_06820
    MSSA476:
    SAS0702
    Mu3:
    SAHV_0734
    Mu50:
    SAV0737
    MW2:
    MW0699
    RF122:
    SAB0689c
    ST398:
    T0131:
    SAT0131_00809
    TCH60:
    HMPREF0772_12447
    TW20:
    SATW20_08120
    USA300_TCH1516:
    USA300HOU_0763
    VC40:
    SAVC_03320

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPKVYGSLIDTETRCRHYFTEEDIIAIKFKCCNKYYPCYKCHNEFEKHAIKRWSEPSFNE
    N315            MPKVYGSLIDTETRCRHYFTEEDIIAIKFKCCNKYYPCYKCHNEFEKHAIKRWSEPSFNE
    NCTC8325        MPKVYGSLIDTETRCRHYFTEEDIIAIKFKCCNKYYPCYKCHNEFEKHAIKRWSEPSFNE
    Newman          MPKVYGSLIDTETRCRHYFTEEDIIAIKFKCCNKYYPCYKCHNEFEKHAIKRWSEPSFNE
                    ************************************************************

    COL             KAILCGVCKHELTINEYMMVERCPNCQSRFNNRCKYHYHIYFEI
    N315            KAILCGVCKHELTINEYMMVERCPNCQSRFNNRCKYHYHIYFEI
    NCTC8325        KAILCGVCKHELTINEYMMVERCPNCQSRFNNRCKYHYHIYFEI
    Newman          KAILCGVCKHELTINEYMMVERCPNCQSRFNNRCKYHYHIYFEI
                    ********************************************