From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002659000
  • symbol?: comFA
  • description?: comf operon protein 1

      descriptions from strain specific annotations:

    • comf operon protein 1
    • putative comf operon protein 1
    • comf operon protein 1, putative
    • ComF operon protein A, DNA transporter ATPase
    • helicase domain-containing protein
    • helicase domain protein
    • late competence operon protein FA
    • putative helicase
    • superfamily II DNA/RNA helicase ComFA
    • type III restriction enzyme, res subunit
  • strand?: +
  • coordinates?: 3155963..3157045
  • synteny block?: BlockID0018940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0728 (comF)
    08BA02176:
    C248_0837
    11819-97:
    MS7_0800
    71193:
    ST398NM01_0826
    ECT-R 2:
    ECTR2_700
    ED133:
    SAOV_0787
    ED98:
    SAAV_0712
    HO 5096 0412:
    SAEMRSA15_06760
    JH1:
    SaurJH1_0791
    JH9:
    SaurJH9_0774
    JKD6008:
    SAA6008_00765
    JKD6159:
    SAA6159_00705
    LGA251:
    SARLGA251_06830
    M013:
    M013TW_0737
    MRSA252:
    SAR0804
    MSHR1132:
    SAMSHR1132_06950
    MSSA476:
    SAS0715
    Mu3:
    SAHV_0747
    Mu50:
    SAV0750
    MW2:
    MW0712
    RF122:
    SAB0702 (comFA)
    ST398:
    SAPIG0826
    T0131:
    SAT0131_00822
    TCH60:
    HMPREF0772_12432
    TW20:
    SATW20_08250
    USA300_TCH1516:
    USA300HOU_0777
    VC40:
    SAVC_03385

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDNVTRYKITESSQSSSQAYYHLSFELSEQQSYASEHIVRAIRKRQTILLYAVTGAGKTE
    N315            ------------------------------------------------------------
    NCTC8325        ------------------------------------------------MLYAVTGAGKTE
    Newman          MDNVTRYKITESSQSSSQAYYHLSFELSEQQSYASEHIVRAIRKRQTILLYAVTGAGKTE
    USA300_FPR3757  MDNVTRYKITESSQSSSQAYYHLSFELSEQQSYASEHIVRAIRKRQTILLYAVTGAGKTE
                                                                                

    COL             MMFQGIQYARIQGDNIAIVSPRVDVVVEISKRIKDAFLNEDIDILHQQSRQQFEGHFVVC
    N315            MMFQGIQYARRQGDNIAIVSPRVDVVVEISKRIKDAFLNEDIDILHQQSSQQFEGHFVVC
    NCTC8325        MMFQGIQYARIQGDNIAIVSPRVDVVVEISKRIKDAFLNEDIDILHQQSRQQFEGHFVVC
    Newman          MMFQGIQYARIQGDNIAIVSPRVDVVVEISKRIKDAFLNEDIDILHQQSRQQFEGHFVVC
    USA300_FPR3757  MMFQGIQYARIQGDNIAIVSPRVDVVVEISKRIKDAFLNEDIDILHQQSRQQFEGHFVVC
                    ********** ************************************** **********

    COL             TVHQLYRFKQHFDTIFIDEVDAFPLSMDKNLQQALKSSSKVEHATIYMTATPPKQLLSEI
    N315            TVHQLYRFKQHFDTIFIDEVDAFPLSMDKSLQQALKSSSKVEHATIYMTATPPKQLLSEI
    NCTC8325        TVHQLYRFKQHFDTIFIDEVDAFPLSMDKNLQQALKSSSKVEHATIYMTATPPKQLLSEI
    Newman          TVHQLYRFKQHFDTIFIDEVDAFPLSMDKNLQQALKSSSKVEHATIYMTATPPKQLLSEI
    USA300_FPR3757  TVHQLYRFKQHFDTIFIDEVDAFPLSMDKNLQQALKSSSKVEHATIYMTATPPKQLLSEI
                    *****************************.******************************

    COL             PHENIIKLPARFHKKSLPVPKYRYFKLNNKKIQKMLYRILQDQINNQRYTLVFFNNIETM
    N315            PHENIIKLPARFHKKSLPVPKYRYFKLNNNKIQKMLYRILQDQINNQRYTLVFFNNIETM
    NCTC8325        PHENIIKLPARFHKKSLPVPKYRYFKLNNKKIQKMLYRILQDQINNQRYTLVFFNNIETM
    Newman          PHENIIKLPARFHKKSLPVPKYRYFKLNNKKIQKMLYRILQDQINNQRYTLVFFNNIETM
    USA300_FPR3757  PHENIIKLPARFHKKSLPVPKYRYFKLNNKKIQKMLYRILQDQINNQRYTLVFFNNIETM
                    *****************************:******************************

    COL             IKTFSVYKQKITKLTYVHSEDVFRFEKVEQLRNGHFDVIFTTTILERGFTMANLDVVVID
    N315            IKTFSVYKQKITKLTYVHSEDVFRFEKVEQLRNGHFDVIFTTTILERGFTMANLDVVVID
    NCTC8325        IKTFSVYKQKITKLTYVHSEDVFRFEKVEQLRNGHFDVIFTTTILERGFTMANLDVVVID
    Newman          IKTFSVYKQKITKLTYVHSEDVFRFEKVEQLRNGHFDVIFTTTILERGFTMANLDVVVID
    USA300_FPR3757  IKTFSVYKQKITKLTYVHSEDVFRFEKVEQLRNGHFDVIFTTTILERGFTMANLDVVVID
                    ************************************************************

    COL             AHQYTQEALIQIAGRVGRKLECPTGKVLFFHEGVSMNMIQAKKEIQRMNKLALKRGWIDE
    N315            AHQYTQEALIQIAGRVGRKLECPAGKVLFFHEGVSMNMIQAKKEIQRMNKLALKRGWIDE
    NCTC8325        AHQYTQEALIQIAGRVGRKLECPTGKVLFFHEGVSMNMIQAKKEIQRMNKLALKRGWIDE
    Newman          AHQYTQEALIQIAGRVGRKLECPTGKVLFFHEGVSMNMIQAKKEIQRMNKLALKRGWIDE
    USA300_FPR3757  AHQYTQEALIQIAGRVGRKLECPTGKVLFFHEGVSMNMIQAKKEIQRMNKLALKRGWIDE
                    ***********************:************************************