From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002661000
  • symbol?: saHPF
  • description?: ribosomal subunit interface protein

      descriptions from strain specific annotations:

    • ribosomal subunit interface protein
    • sigma 54 modulation protein
    • putative S30EA family ribosomal protein
    • ribosome-associated factor Y
    • ribosome-associated inhibitor protein Y
    • S30EA family ribosomal protein
    • sigma 54 modulation protein/ribosomal protein S30EA
  • strand?: +
  • coordinates?: 3157773..3158345
  • synteny block?: BlockID0018960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0730
    08BA02176:
    C248_0839
    11819-97:
    MS7_0802 (raiA)
    71193:
    ST398NM01_0828
    ECT-R 2:
    ECTR2_702 (raiA)
    ED133:
    SAOV_0789
    ED98:
    SAAV_0714
    HO 5096 0412:
    SAEMRSA15_06780
    JH1:
    SaurJH1_0793
    JH9:
    SaurJH9_0776
    JKD6008:
    SAA6008_00767 (yfiA)
    JKD6159:
    SAA6159_00707 (yfiA)
    LGA251:
    SARLGA251_06850
    M013:
    M013TW_0739
    MRSA252:
    SAR0806
    MSHR1132:
    SAMSHR1132_06970
    MSSA476:
    SAS0717
    Mu3:
    SAHV_0749
    Mu50:
    SAV0752
    MW2:
    MW0714
    RF122:
    SAB0704
    ST398:
    SAPIG0828
    T0131:
    SAT0131_00824
    TCH60:
    HMPREF0772_12430 (yfiA)
    TW20:
    SATW20_08270
    USA300_TCH1516:
    USA300HOU_0779
    VC40:
    SAVC_03395

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIRFEIHGDNLTITDAIRNYIEEKIGKLERYFNDVPNAVAHVKVKTYSNSATKIEVTIPL
    N315            MIRFEIHGDNLTITDAIRNYIEEKIGKLERYFNDVPNAVAHVKVKTYSNSATKIEVTIPL
    NCTC8325        MIRFEIHGDNLTITDAIRNYIEEKIGKLERYFNDVPNAVAHVKVKTYSNSATKIEVTIPL
    Newman          MIRFEIHGDNLTITDAIRNYIEEKIGKLERYFNDVPNAVAHVKVKTYSNSATKIEVTIPL
    USA300_FPR3757  MIRFEIHGDNLTITDAIRNYIEEKIGKLERYFNDVPNAVAHVKVKTYSNSATKIEVTIPL
                    ************************************************************

    COL             KNVTLRAEERNDDLYAGIDLINNKLERQVRKYKTRINRKSRDRGDQEVFVAELQEMQETQ
    N315            KNVTLRAEERNDDLYAGIDLINNKLERQVRKYKTRINRKSRDRGDQEVFVAELQEMQETQ
    NCTC8325        KNVTLRAEERNDDLYAGIDLINNKLERQVRKYKTRINRKSRDRGDQEVFVAELQEMQETQ
    Newman          KNVTLRAEERNDDLYAGIDLINNKLERQVRKYKTRINRKSRDRGDQEVFVAELQEMQETQ
    USA300_FPR3757  KNVTLRAEERNDDLYAGIDLINNKLERQVRKYKTRINRKSRDRGDQEVFVAELQEMQETQ
                    ************************************************************

    COL             VDNDAYDDNEIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFIDRETDGTSIVYRRKDG
    N315            VDNDAYDDNEIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDG
    NCTC8325        VDNDAYDDNEIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDG
    Newman          VDNDAYDDNEIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDG
    USA300_FPR3757  VDNDAYDDNEIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDG
                    ******************************************* ****************

    COL             KYGLIQTSEQ
    N315            KYGLIQTSEQ
    NCTC8325        KYGLIQTSEQ
    Newman          KYGLIQTSEQ
    USA300_FPR3757  KYGLIQTSEQ
                    **********