From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002662000
  • symbol?: secA
  • description?: preprotein translocase subunit SecA

      descriptions from strain specific annotations:

    • preprotein translocase subunit SecA
    • Protein export cytoplasm protein SecA ATPase RNA helicase
    • Protein translocase subunit secA 1
    • Sec family Type I general secretory pathway preprotein translocase subunit SecA
    • preprotein translocase, SecA subunit
  • strand?: +
  • coordinates?: 3158760..3161297
  • synteny block?: BlockID0018970
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0816 (secA)
    N315:
    SA0708 (secA)
    NCTC8325:
    Newman:
    NWMN_0722 (secA)
    USA300_FPR3757:
    04-02981:
    SA2981_0731 (secA)
    08BA02176:
    C248_0840 (secA)
    11819-97:
    MS7_0803
    71193:
    ST398NM01_0829
    ECT-R 2:
    ECTR2_703 (secA)
    ED133:
    SAOV_0790
    ED98:
    SAAV_0715 (secA)
    HO 5096 0412:
    SAEMRSA15_06790 (secA)
    JH1:
    SaurJH1_0794 (secA)
    JH9:
    SaurJH9_0777 (secA)
    JKD6008:
    SAA6008_00768 (secA)
    JKD6159:
    SAA6159_00708 (secA)
    LGA251:
    SARLGA251_06860 (secA)
    M013:
    M013TW_0740
    MRSA252:
    SAR0807 (secA)
    MSHR1132:
    SAMSHR1132_06980
    MSSA476:
    SAS0718 (secA)
    Mu3:
    SAHV_0750 (secA)
    Mu50:
    SAV0753 (secA)
    MW2:
    MW0715 (secA)
    RF122:
    SAB0705 (secA)
    ST398:
    SAPIG0829 (secA)
    T0131:
    SAT0131_00825
    TCH60:
    HMPREF0772_12429 (secA2)
    TW20:
    SATW20_08280 (secA)
    USA300_TCH1516:
    USA300HOU_0780 (secA1)
    VC40:
    SAVC_03400

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGFLSKILDGNNKEIKQLGKLADKVIALEEKTAILTDEEIRNKTKQFQTELADIDNVKKQ
    N315            MGFLSKILDGNNKEIKQLGKLADKVIALEEKTAILTDEEIRNKTKQFQTELADIDNVKKQ
    NCTC8325        MGFLSKILDGNNKEIKQLGKLADKVIALEEKTAILTDEEIRNKTKQFQTELADIDNVKKQ
    Newman          MGFLSKILDGNNKEIKQLGKLADKVIALEEKTAILTDEEIRNKTKQFQTELADIDNVKKQ
    USA300_FPR3757  MGFLSKILDGNNKEIKQLGKLADKVIALEEKTAILTDEEIRNKTKQFQTELADIDNVKKQ
                    ************************************************************

    COL             NDYLDKILPEAYALVREGSKRVFNMTPYKVQIMGGIAIHKGDIAEMRTGEGKTLTATMPT
    N315            NDYLDKILPEAYALVREGSKRVFNMTPYKVQIMGGIAIHKGDIAEMRTGEGKTLTATMPT
    NCTC8325        NDYLDKILPEAYALVREGSKRVFNMTPYKVQIMGGIAIHKGDIAEMRTGEGKTLTATMPT
    Newman          NDYLDKILPEAYALVREGSKRVFNMTPYKVQIMGGIAIHKGDIAEMRTGEGKTLTATMPT
    USA300_FPR3757  NDYLDKILPEAYALVREGSKRVFNMTPYKVQIMGGIAIHKGDIAEMRTGEGKTLTATMPT
                    ************************************************************

    COL             YLNALAGRGVHVITVNEYLSSVQSEEMAELYNFLGLTVGLNLNSKTTEEKREAYAQDITY
    N315            YLNALAGRGVHVITVNEYLSSVQSEEMAELYNFLGLTVGLNLNSKTTEEKREAYAQDITY
    NCTC8325        YLNALAGRGVHVITVNEYLSSVQSEEMAELYNFLGLTVGLNLNSKTTEEKREAYAQDITY
    Newman          YLNALAGRGVHVITVNEYLSSVQSEEMAELYNFLGLTVGLNLNSKTTEEKREAYAQDITY
    USA300_FPR3757  YLNALAGRGVHVITVNEYLSSVQSEEMAELYNFLGLTVGLNLNSKTTEEKREAYAQDITY
                    ************************************************************

    COL             STNNELGFDYLRDNMVNYSEDRVMRPLHFAIIDEVDSILIDEARTPLIISGEAEKSTSLY
    N315            STNNELGFDYLRDNMVNYSEDRVMRPLHFAIIDEVDSILIDEARTPLIISGEAEKSTSLY
    NCTC8325        STNNELGFDYLRDNMVNYSEDRVMRPLHFAIIDEVDSILIDEARTPLIISGEAEKSTSLY
    Newman          STNNELGFDYLRDNMVNYSEDRVMRPLHFAIIDEVDSILIDEARTPLIISGEAEKSTSLY
    USA300_FPR3757  STNNELGFDYLRDNMVNYSEDRVMRPLHFAIIDEVDSILIDEARTPLIISGEAEKSTSLY
                    ************************************************************

    COL             TQANVFAKMLKQDEDYKYDEKTKAVHLTEQGADKAERMFKVENLYDVQNVDVISHINTAL
    N315            TQANVFAKMLKQDEDYKYDEKTKAVHLTEQGADKAERMFKVENLYDVQNVDVISHINTAL
    NCTC8325        TQANVFAKMLKQDEDYKYDEKTKAVHLTEQGADKAERMFKVENLYDVQNVDVISHINTAL
    Newman          TQANVFAKMLKQDEDYKYDEKTKAVHLTEQGADKAERMFKVENLYDVQNVDVISHINTAL
    USA300_FPR3757  TQANVFAKMLKQDEDYKYDEKTKAVHLTEQGADKAERMFKVENLYDVQNVDVISHINTAL
                    ************************************************************

    COL             RAHVTLQRDVDYMVVDGEVLIVDQFTGRTMPGRRFSEGLHQAIEAKEGVQIQNESKTMAS
    N315            RAHVTLQRDVDYMVVDGEVLIVDQFTGRTMPGRRFSEGLHQAIEAKEGVQIQNESKTMAS
    NCTC8325        RAHVTLQRDVDYMVVDGEVLIVDQFTGRTMPGRRFSEGLHQAIEAKEGVQIQNESKTMAS
    Newman          RAHVTLQRDVDYMVVDGEVLIVDQFTGRTMPGRRFSEGLHQAIEAKEGVQIQNESKTMAS
    USA300_FPR3757  RAHVTLQRDVDYMVVDGEVLIVDQFTGRTMPGRRFSEGLHQAIEAKEGVQIQNESKTMAS
                    ************************************************************

    COL             ITFQNYFRMYNKLAGMTGTAKTEEEEFRNIYNMTVTQIPTNKPVQRNDKSDLIYISQKGK
    N315            ITFQNYFRMYNKLAGMTGTAKTEEEEFRNIYNMTVTQIPTNKPVQRNDKSDLIYISQKGK
    NCTC8325        ITFQNYFRMYNKLAGMTGTAKTEEEEFRNIYNMTVTQIPTNKPVQRNDKSDLIYISQKGK
    Newman          ITFQNYFRMYNKLAGMTGTAKTEEEEFRNIYNMTVTQIPTNKPVQRNDKSDLIYISQKGK
    USA300_FPR3757  ITFQNYFRMYNKLAGMTGTAKTEEEEFRNIYNMTVTQIPTNKPVQRNDKSDLIYISQKGK
                    ************************************************************

    COL             FDAVVEDVVEKHKAGQPVLLGTVAVETSEYISNLLKKRGIRHDVLNAKNHEREAEIVAGA
    N315            FDAVVEDVVEKHKAGQPVLLGTVAVETSEYISNLLKKRGIRHDVLNAKNHEREAEIVAGA
    NCTC8325        FDAVVEDVVEKHKAGQPVLLGTVAVETSEYISNLLKKRGIRHDVLNAKNHEREAEIVAGA
    Newman          FDAVVEDVVEKHKAGQPVLLGTVAVETSEYISNLLKKRGIRHDVLNAKNHEREAEIVAGA
    USA300_FPR3757  FDAVVEDVVEKHKAGQPVLLGTVAVETSEYISNLLKKRGIRHDVLNAKNHEREAEIVAGA
                    ************************************************************

    COL             GQKGAVTIATNMAGRGTDIKLGEGVEELGGLAVIGTERHESRRIDDQLRGRSGRQGDKGD
    N315            GQKGAVTIATNMAGRGTDIKLGEGVEELGGLAVIGTERHESRRIDDQLRGRSGRQGDKGD
    NCTC8325        GQKGAVTIATNMAGRGTDIKLGEGVEELGGLAVIGTERHESRRIDDQLRGRSGRQGDKGD
    Newman          GQKGAVTIATNMAGRGTDIKLGEGVEELGGLAVIGTERHESRRIDDQLRGRSGRQGDKGD
    USA300_FPR3757  GQKGAVTIATNMAGRGTDIKLGEGVEELGGLAVIGTERHESRRIDDQLRGRSGRQGDKGD
                    ************************************************************

    COL             SRFYLSLQDELMIRFGSERLQKMMSRLGLDDSTPIESKMVSRAVESAQKRVEGNNFDARK
    N315            SRFYLSLQDELMIRFGSERLQKMMSRLGLDDSTPIESKMVSRAVESAQKRVEGNNFDARK
    NCTC8325        SRFYLSLQDELMIRFGSERLQKMMSRLGLDDSTPIESKMVSRAVESAQKRVEGNNFDARK
    Newman          SRFYLSLQDELMIRFGSERLQKMMSRLGLDDSTPIESKMVSRAVESAQKRVEGNNFDARK
    USA300_FPR3757  SRFYLSLQDELMIRFGSERLQKMMSRLGLDDSTPIESKMVSRAVESAQKRVEGNNFDARK
                    ************************************************************

    COL             RILEYDEVLRKQREIIYNERNSIIDEEDSSQVVDAMLRSTLQRSINYYINTADDEPEYQP
    N315            RILEYDEVLRKQREIIYNERNSIIDEEDSSQVVDAMLRSTLQRSINYYINTADDEPEYQP
    NCTC8325        RILEYDEVLRKQREIIYNERNSIIDEEDSSQVVDAMLRSTLQRSINYYINTADDEPEYQP
    Newman          RILEYDEVLRKQREIIYNERNSIIDEEDSSQVVDAMLRSTLQRSINYYINTADDEPEYQP
    USA300_FPR3757  RILEYDEVLRKQREIIYNERNSIIDEEDSSQVVDAMLRSTLQRSINYYINTADDEPEYQP
                    ************************************************************

    COL             FIDYINDIFLQEGDITEDDIKGKDAEDIFEVVWAKIEAAYQSQKDILEEQMNEFERMILL
    N315            FIDYINDIFLQEGDITEDDIKGKDAEDIFEVVWAKIEAAYQSQKDILEEQMNEFERMILL
    NCTC8325        FIDYINDIFLQEGDITEDDIKGKDAEDIFEVVWAKIEAAYQSQKDILEEQMNEFERMILL
    Newman          FIDYINDIFLQEGDITEDDIKGKDAEDIFEVVWAKIEAAYQSQKDILEEQMNEFERMILL
    USA300_FPR3757  FIDYINDIFLQEGDITEDDIKGKDAEDIFEVVWAKIEAAYQSQKDILEEQMNEFERMILL
                    ************************************************************

    COL             RSIDSHWTDHIDTMDQLRQGIHLRSYAQQNPLRDYQNEGHELFDIMMQNIEEDTCKFILK
    N315            RSIDSHWTDHIDTMDQLRQGIHLRSYAQQNPLRDYQNEGHELFDIMMQNIEEDTCKFILK
    NCTC8325        RSIDSHWTDHIDTMDQLRQGIHLRSYAQQNPLRDYQNEGHELFDIMMQNIEEDTCKFILK
    Newman          RSIDSHWTDHIDTMDQLRQGIHLRSYAQQNPLRDYQNEGHELFDIMMQNIEEDTCKFILK
    USA300_FPR3757  RSIDSHWTDHIDTMDQLRQGIHLRSYAQQNPLRDYQNEGHELFDIMMQNIEEDTCKFILK
                    ************************************************************

    COL             SVVQVEDNIEREKTTEFGEAKHVSAEDGKEKVKPKPIVKGDQVGRNDDCPCGSGKKFKNC
    N315            SVVQVEDNIEREKTTEFGEAKHVSAEDGKEKVKPKPIVKGDQVGRNDDCPCGSGKKFKNC
    NCTC8325        SVVQVEDNIEREKTTEFGEAKHVSAEDGKEKVKPKPIVKGDQVGRNDDCPCGSGKKFKNC
    Newman          SVVQVEDNIEREKTTEFGEAKHVSAEDGKEKVKPKPIVKGDQVGRNDDCPCGSGKKFKNC
    USA300_FPR3757  SVVQVEDNIEREKTTEFGEAKHVSAEDGKEKVKPKPIVKGDQVGRNDDCPCGSGKKFKNC
                    ************************************************************

    COL             HGK
    N315            HGK
    NCTC8325        HGK
    Newman          HGK
    USA300_FPR3757  HGK
                    ***