From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002664000
  • symbol?: prfB
  • description?: peptide chain release factor 2

      descriptions from strain specific annotations:

    • peptide chain release factor 2
    • pseudogene
    • peptide chain release factor RF2
    • peptide chain release factor 2 (RF-2)
  • strand?: +
  • coordinates?: 3161633..3162743
  • synteny block?: BlockID0018990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0818 (prfB)
    N315:
    SA0709 (prfB)
    NCTC8325:
    Newman:
    NWMN_0723 (prfB)
    USA300_FPR3757:
    04-02981:
    SA2981_0732 (prfB)
    08BA02176:
    C248_0841 (prfB)
    11819-97:
    MS7_0804 (prfB)
    71193:
    ST398NM01_0830
    ECT-R 2:
    ECTR2_704 (prfB)
    ED133:
    SAOV_0791
    ED98:
    SAAV_0717 (prfB)
    HO 5096 0412:
    SAEMRSA15_06800 (prfB)
    JH1:
    SaurJH1_0795 (prfB)
    JH9:
    SaurJH9_0778 (prfB)
    JKD6008:
    SAA6008_00769
    JKD6159:
    SAA6159_00709
    LGA251:
    SARLGA251_06870 (prfB)
    M013:
    M013TW_0741
    MRSA252:
    SAR0808 (prfB)
    MSHR1132:
    SAMSHR1132_06990
    MSSA476:
    SAS0719 (prfB)
    Mu3:
    SAHV_0751 (prfB)
    Mu50:
    SAV0754 (prfB)
    MW2:
    MW0716 (prfB)
    RF122:
    SAB0706 (prfB)
    ST398:
    SAPIG0830 (prfB)
    T0131:
    SAT0131_00826
    TCH60:
    HMPREF0772_12428 (prfB)
    TW20:
    SATW20_08290 (prfB)
    USA300_TCH1516:
    USA300HOU_0782 (prfB)
    VC40:
    SAVC_03405 (prfB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MELSEIKRNIDKYNQDLTQIRGSLDLENKETNIQEYEEMMAEPNFWDNQTKAQDIIDKNN
    N315            ---------------------------------------MAEPNFWDNQTKAQDIIDKNN
    NCTC8325        ------------------------------------------------------------
    Newman          --------------------------------------MMAEPNFWDNQTKAQDIIDKNN
                                                                                

    COL             ALKAIVNGYKTLQAEVDDMDATWDLLQEEFDEEMKEDLEQEVINFKAKVDEYELQLLLDG
    N315            ALKAIVNGYKTLQAEVDDMDATWDLLQEEFDEEMKEDLEQEVINFKAKVDEYELQLLLDG
    NCTC8325        ------------------MDATWDLLQEEFDEEMKEDLEQEVINFKAKVDEYELQLLLDG
    Newman          ALKAIVNGYKTLQAEVDDMDATWDLLQEEFDEEMKEDLEQEVINFKAKVDEYELQLLLDG
                                      ******************************************

    COL             PHDANNAILELHPGAGGTESQDWANMLFRMYQRYCEKKGFKVETVDYLPGDEAGIKSVTL
    N315            PHDANNAILELHPGAGGTESQDWANMLFRMYQRYCEKKGFKVETVDYLPGDEAGIKSVTL
    NCTC8325        PHDANNAILELHPGAGGTESQDWANMLFRMYQRYCEKKGFKVETVDYLPGDEAGIKSVTL
    Newman          PHDANNAILELHPGAGGTESQDWANMLFRMYQRYCEKKGFKVETVDYLPGDEAGIKSVTL
                    ************************************************************

    COL             LIKGHNAYGYLKAEKGVHRLVRISPFDSSGRRHTSFASCDVIPDFNNDEIEIEINPDDIT
    N315            LIKGHNAYGYLKAEKGVHRLVRISPFDSSGRRHTSFASCDVIPDFNNDEIEIEINPDDIT
    NCTC8325        LIKGHNAYGYLKAEKGVHRLVRISPFDSSGRRHTSFASCDVIPDFNNDEIEIEINPDDIT
    Newman          LIKGHNAYGYLKAEKGVHRLVRISPFDSSGRRHTSFASCDVIPDFNNDEIEIEINPDDIT
                    ************************************************************

    COL             VDTFRASGAGGQHINKTESAIRITHHPSGIVVNNQNERSQIKNREAAMKMLKSKLYQLKL
    N315            VDTFRASGAGGQHINKTESAIRITHHPSGIVVNNQNERSQIKNREAAMKMLKSKLYQLKL
    NCTC8325        VDTFRASGAGGQHINKTESAIRITHHPSGIVVNNQNERSQIKNREAAMKMLKSKLYQLKL
    Newman          VDTFRASGAGGQHINKTESAIRITHHPSGIVVNNQNERSQIKNREAAMKMLKSKLYQLKL
                    ************************************************************

    COL             EEQAREMAEIRGEQKEIGWGSQIRSYVFHPYSMVKDHRTNEETGKVDAVMDGDIGPFIES
    N315            EEQAREMAEIRGEQKEIGWGSQIRSYVFHPYSMVKDHRTNEETGKVDAVMDGDIGPFIES
    NCTC8325        EEQAREMAEIRGEQKEIGWGSQIRSYVFHPYSMVKDHRTNEETGKVDAVMDGDIGPFIES
    Newman          EEQAREMAEIRGEQKEIGWGSQIRSYVFHPYSMVKDHRTNEETGKVDAVMDGDIGPFIES
                    ************************************************************

    COL             YLRQTMSHD
    N315            YLRQTMSHD
    NCTC8325        YLRQTMSHD
    Newman          YLRQTMSHD
                    *********