From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002676000
  • symbol?: uvrA
  • description?: excinuclease ABC subunit A

      descriptions from strain specific annotations:

    • excinuclease ABC subunit A
    • excision endonuclease subunit UvrA
    • UvrABC system protein A
    • excinuclease ABC, A subunit
    • exinuclease ABC subunit A
  • strand?: +
  • coordinates?: 3170652..3173498
  • synteny block?: BlockID0019090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0824 (uvrA)
    N315:
    SA0714 (uvrA)
    NCTC8325:
    Newman:
    NWMN_0727 (uvrA)
    USA300_FPR3757:
    04-02981:
    SA2981_0737 (uvrA)
    08BA02176:
    C248_0846 (uvrA)
    11819-97:
    MS7_0809 (uvrA)
    71193:
    ST398NM01_0835
    ECT-R 2:
    ECTR2_709 (uvrA)
    ED133:
    SAOV_0796
    ED98:
    SAAV_0722 (uvrA)
    HO 5096 0412:
    SAEMRSA15_06850 (uvrA)
    JH1:
    SaurJH1_0800 (uvrA)
    JH9:
    SaurJH9_0783 (uvrA)
    JKD6008:
    SAA6008_00774 (uvrA)
    JKD6159:
    SAA6159_00714 (uvrA)
    LGA251:
    SARLGA251_06920 (uvrA)
    M013:
    M013TW_0746
    MRSA252:
    SAR0813 (uvrA)
    MSHR1132:
    SAMSHR1132_07040
    MSSA476:
    SAS0724 (uvrA)
    Mu3:
    SAHV_0756 (uvrA)
    Mu50:
    SAV0759 (uvrA)
    MW2:
    MW0721 (uvrA)
    RF122:
    SAB0712 (uvrA)
    ST398:
    SAPIG0835 (uvrA)
    T0131:
    SAT0131_00831
    TCH60:
    HMPREF0772_12422 (uvrA)
    TW20:
    SATW20_08340 (uvrA)
    USA300_TCH1516:
    USA300HOU_0787 (uvrA)
    VC40:
    SAVC_03430 (uvrA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKEPSIVVKGARAHNLKDIDIELPKNKLIVMTGLSGSGKSSLAFDTIYAEGQRRYVESLS
    N315            MKEPSIVVKGARAHNLKDIDIELPKNKLIVMTGLSGSGKSSLAFDTIYAEGQRRYVESLS
    NCTC8325        MKEPSIVVKGARAHNLKDIDIELPKNKLIVMTGLSGSGKSSLAFDTIYAEGQRRYVESLS
    Newman          MKEPSIVVKGARAHNLKDIDIELPKNKLIVMTGLSGSGKSSLAFDTIYAEGQRRYVESLS
    USA300_FPR3757  MKEPSIVVKGARAHNLKDIDIELPKNKLIVMTGLSGSGKSSLAFDTIYAEGQRRYVESLS
                    ************************************************************

    COL             AYARQFLGQMDKPDVDTIEGLSPAISIDQKTTSKNPRSTVATVTEIYDYIRLLYARVGKP
    N315            AYARQFLGQMDKPDVDTIEGLSPAISIDQKTTSKNPRSTVATVTEIYDYIRLLYARVGKP
    NCTC8325        AYARQFLGQMDKPDVDTIEGLSPAISIDQKTTSKNPRSTVATVTEIYDYIRLLYARVGKP
    Newman          AYARQFLGQMDKPDVDTIEGLSPAISIDQKTTSKNPRSTVATVTEIYDYIRLLYARVGKP
    USA300_FPR3757  AYARQFLGQMDKPDVDTIEGLSPAISIDQKTTSKNPRSTVATVTEIYDYIRLLYARVGKP
                    ************************************************************

    COL             YCPNHNIEIESQTVQQMVDRIMELEARTKIQLLAPVIAHRKGSHEKLIEDIGKKGYVRLR
    N315            YCPNHNIEIESQTVQQMVDRIMELEARTKIQLLAPVIAHRKGSHEKLIEDIGKKGYVRLR
    NCTC8325        YCPNHNIEIESQTVQQMVDRIMELEARTKIQLLAPVIAHRKGSHEKLIEDIGKKGYVRLR
    Newman          YCPNHNIEIESQTVQQMVDRIMELEARTKIQLLAPVIAHRKGSHEKLIEDIGKKGYVRLR
    USA300_FPR3757  YCPNHNIEIESQTVQQMVDRIMELEARTKIQLLAPVIAHRKGSHEKLIEDIGKKGYVRLR
                    ************************************************************

    COL             IDGEIVDVNDVPTLDKNKNHTIEVVVDRLVVKDGIETRLADSIETALELSEGQLTVDVID
    N315            IDGEIVDVNDVPTLDKNKNHTIEVVVDRLVVKDGIETRLADSIETALELSEGQLTVDVID
    NCTC8325        IDGEIVDVNDVPTLDKNKNHTIEVVVDRLVVKDGIETRLADSIETALELSEGQLTVDVID
    Newman          IDGEIVDVNDVPTLDKNKNHTIEVVVDRLVVKDGIETRLADSIETALELSEGQLTVDVID
    USA300_FPR3757  IDGEIVDVNDVPTLDKNKNHTIEVVVDRLVVKDGIETRLADSIETALELSEGQLTVDVID
                    ************************************************************

    COL             GEDLKFSESHACPICGFSIGELEPRMFSFNSPFGACPTCDGLGQKLTVDVDLVVPDKDKT
    N315            GEDLKFSESHACPICGFSIGELEPRMFSFNSPFGACPTCDGLGQKLTVDVDLVVPDKDKT
    NCTC8325        GEDLKFSESHACPICGFSIGELEPRMFSFNSPFGACPTCDGLGQKLTVDVDLVVPDKDKT
    Newman          GEDLKFSESHACPICGFSIGELEPRMFSFNSPFGACPTCDGLGQKLTVDVDLVVPDKDKT
    USA300_FPR3757  GEDLKFSESHACPICGFSIGELEPRMFSFNSPFGACPTCDGLGQKLTVDVDLVVPDKDKT
                    ************************************************************

    COL             LNEGAIEPWIPTSSDFYPTLLKRVCEVYKINMDKPFKKLTERQRDILLYGSGDKEIEFTF
    N315            LNEGAIEPWIPTSSDFYPTLLKRVCEVYKINMDKPFKKLTERQRDILLYGSGDKEIEFTF
    NCTC8325        LNEGAIEPWIPTSSDFYPTLLKRVCEVYKINMDKPFKKLTERQRDILLYGSGDKEIEFTF
    Newman          LNEGAIEPWIPTSSDFYPTLLKRVCEVYKINMDKPFKKLTERQRDILLYGSGDKEIEFTF
    USA300_FPR3757  LNEGAIEPWIPTSSDFYPTLLKRVCEVYKINMDKPFKKLTERQRDILLYGSGDKEIEFTF
                    ************************************************************

    COL             TQRQGGTRKRTMVFEGVVPNISRRFHESPSEYTREMMSKYMTELPCETCHGKRLSREALS
    N315            TQRQGGTRKRTMVFEGVVPNISRRFHESPSEYTREMMSKYMTELPCETCHGKRLSREALS
    NCTC8325        TQRQGGTRKRTMVFEGVVPNISRRFHESPSEYTREMMSKYMTELPCETCHGKRLSREALS
    Newman          TQRQGGTRKRTMVFEGVVPNISRRFHESPSEYTREMMSKYMTELPCETCHGKRLSREALS
    USA300_FPR3757  TQRQGGTRKRTMVFEGVVPNISRRFHESPSEYTREMMSKYMTELPCETCHGKRLSREALS
                    ************************************************************

    COL             VYVGGLNIGEVVEYSISQALNYYKNIDLSEQDQAIANQILKEIISRLTFLNNVGLEYLTL
    N315            VYVGGLNIGEVVEYSISQALNYYKNIDLSEQDQAIANQILKEIISRLTFLNNVGLEYLTL
    NCTC8325        VYVGGLNIGEVVEYSISQALNYYKNIDLSEQDQAIANQILKEIISRLTFLNNVGLEYLTL
    Newman          VYVGGLNIGEVVEYSISQALNYYKNIDLSEQDQAIANQILKEIISRLTFLNNVGLEYLTL
    USA300_FPR3757  VYVGGLNIGEVVEYSISQALNYYKNIDLSEHDQAIANQILKEIISRLTFLNNVGLEYLTL
                    ******************************:*****************************

    COL             NRASGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLINTLKEMRDLGNT
    N315            NRASGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLINTLKEMRDLGNT
    NCTC8325        NRASGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLINTLKEMRDLGNT
    Newman          NRASGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLINTLKEMRDLGNT
    USA300_FPR3757  NRASGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLINTLKEMRDLGNT
                    ************************************************************

    COL             LIVVEHDDDTMRAADYLVDIGPGAGEHGGQIVSSGTPQKVMKDKKSLTGQYLSGKKRIEV
    N315            LIVVEHDDDTMRAADYLVDIGPGAGEHGGQIVSSGTPQKVMKDKKSLTGQYLSGKKRIDV
    NCTC8325        LIVVEHDDDTMRAADYLVDIGPGAGEHGGQIVSSGTPQKVMKDKKSLTGQYLSGKKRIEV
    Newman          LIVVEHDDDTMRAADYLVDIGPGAGEHGGQIVSSGTPQKVMKDKKSLTGQYLSGKKRIEV
    USA300_FPR3757  LIVVEHDDDTMRAADYLVDIGPGAGEHGGQIVSSGTPQKVMKDKKSLTGQYLSGKKRIEV
                    **********************************************************:*

    COL             PEYRRPASDRKISIRGARSNNLKGVDVDIPLSIMTVVTGVSGSGKSSLVNEVLYKSLAQK
    N315            PEYRRPASDRKISIRGARSNNLKGIDVDIPLSIMTVVTGVSGSGKSSLVNEVLYKSLAQK
    NCTC8325        PEYRRPASDRKISIRGARSNNLKGVDVDIPLSIMTVVTGVSGSGKSSLVNEVLYKSLAQK
    Newman          PEYRRPASDRKISIRGARSNNLKGVDVDIPLSIMTVVTGVSGSGKSSLVNEVLYKSLAQK
    USA300_FPR3757  PEYRRPASDRKISIRGARSNNLKGVDVDIPLSIMTVVTGVSGSGKSSLVNEVLYKSLAQK
                    ************************:***********************************

    COL             INKSKVKPGLYDKIEGIDQLDKIIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAQTNEAK
    N315            INKSKVKPGLYDKIEGIDQLDKIIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAQTNEAK
    NCTC8325        INKSKVKPGLYDKIEGIDQLDKIIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAQTNEAK
    Newman          INKSKVKPGLYDKIEGIDQLDKIIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAQTNEAK
    USA300_FPR3757  INKSKVKPGLYDKIEGIDQLDKIIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAQTNEAK
                    ************************************************************

    COL             IRGYQKGRFSFNVKGGRCEACKGDGIIKIEMHFLPDVYVPCEVCDGKRYNRETLEVTYKG
    N315            IRGYQKGRFSFNVKGGRCEACKGDGIIKIEMHFLPDVYVPCEVCDGKRYNRETLEVTYKG
    NCTC8325        IRGYQKGRFSFNVKGGRCEACKGDGIIKIEMHFLPDVYVPCEVCDGKRYNRETLEVTYKG
    Newman          IRGYQKGRFSFNVKGGRCEACKGDGIIKIEMHFLPDVYVPCEVCDGKRYNRETLEVTYKG
    USA300_FPR3757  IRGYQKGRFSFNVKGGRCEACKGDGIIKIEMHFLPDVYVPCEVCDGKRYNRETLEVTYKG
                    ************************************************************

    COL             KNIADILEMTVEEATQFFENIPKIKRKLQTLVDVGLGYVTLGQQATTLSGGEAQRVKLAS
    N315            KNIADILEMTVEEATQFFENIPKIKRKLQTLVDVGLGYVTLGQQATTLSGGEAQRVKLAS
    NCTC8325        KNIADILEMTVEEATQFFENIPKIKRKLQTLVDVGLGYVTLGQQATTLSGGEAQRVKLAS
    Newman          KNIADILEMTVEEATQFFENIPKIKRKLQTLVDVGLGYVTLGQQATTLSGGEAQRVKLAS
    USA300_FPR3757  KNIADILEMTVEEATQFFENIPKIKRKLQTLVDVGLGYVTLGQQATTLSGGEAQRVKLAS
                    ************************************************************

    COL             ELHKRSTGKSIYILDEPTTGLHVDDISRLLKVLNRLVENGDTVVIIEHNLDVIKTADYII
    N315            ELHKRSTGKSIYILDELTTGLHVDDISRLLKVLNRLVENGDTVVIIEHNLDVIKTADYII
    NCTC8325        ELHKRSTGKSIYILDEPTTGLHVDDISRLLKVLNRLVENGDTVVIIEHNLDVIKTADYII
    Newman          ELHKRSTGKSIYILDEPTTGLHVDDISRLLKVLNRLVENGDTVVIIEHNLDVIKTADYII
    USA300_FPR3757  ELHKRSTGKSIYILDEPTTGLHVDDISRLLKVLNRLVENGDTVVIIEHNLDVIKTADYII
                    **************** *******************************************

    COL             DLGPEGGSGGGTIVATGTPEDIAQTKSSYTGKYLKEVLERDKQNTEDK
    N315            DLGPEGGSGGGTIVATGTPEDIAQTKSSYTGKYLKEVLERDKQNTEDK
    NCTC8325        DLGPEGGSGGGTIVATGTPEDIAQTKSSYTGKYLKEVLERDKQNTEDK
    Newman          DLGPEGGSGGGTIVATGTPEDIAQTKSSYTGKYLKEVLERDKQNTEDK
    USA300_FPR3757  DLGPEGGSGGGTIVATGTPEDIAQTKSSYTGKYLKEVLERDKQNTEDK
                    ************************************************