From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002681000
  • symbol?:
  • description?: O-acetyltransferase

      descriptions from strain specific annotations:

    • O-acetyltransferase
    • hexapaptide repeat-containing transferase
    • putative acetyltransferase
    • maltose O-acetyltransferase (Maltose transacetylase). domain protein
    • bacterial transferase hexapeptide family protein
  • strand?: +
  • coordinates?: 3179570..3180049
  • synteny block?: BlockID0019130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0740
    08BA02176:
    C248_0849
    11819-97:
    MS7_0812
    71193:
    ST398NM01_0838
    ECT-R 2:
    ECTR2_712
    ED133:
    SAOV_0799
    ED98:
    SAAV_0725
    HO 5096 0412:
    SAEMRSA15_06880
    JH1:
    SaurJH1_0803
    JH9:
    SaurJH9_0786
    JKD6008:
    SAA6008_00777
    JKD6159:
    SAA6159_00719
    LGA251:
    SARLGA251_06950
    M013:
    M013TW_0749
    MRSA252:
    SAR0816
    MSHR1132:
    SAMSHR1132_07070
    MSSA476:
    SAS0727
    Mu3:
    SAHV_0759
    Mu50:
    SAV0762
    MW2:
    MW0724
    RF122:
    SAB0715
    ST398:
    SAPIG0838
    T0131:
    SAT0131_00834
    TCH60:
    HMPREF0772_12419 (maa)
    TW20:
    SATW20_08370
    USA300_TCH1516:
    USA300HOU_0790
    VC40:
    SAVC_03445

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGN
    N315            MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGN
    NCTC8325        MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGN
    Newman          MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGN
    USA300_FPR3757  MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGN
                    ************************************************************

    COL             QSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANAT
    N315            QSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANAT
    NCTC8325        QSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANAT
    Newman          QSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANAT
    USA300_FPR3757  QSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANAT
                    ************************************************************

    COL             ILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR
    N315            ILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR
    NCTC8325        ILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR
    Newman          ILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR
    USA300_FPR3757  ILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR
                    *****************************************