From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002682000
  • symbol?:
  • description?: TPR domain-containing protein

      descriptions from strain specific annotations:

    • TPR domain-containing protein
    • anaphase-promoting complex, cyclosome, subunit 3 family protein
    • tetratricopeptide (TPR) domain protein
    • TPR domain protein
    • TRP domain-containing protein
  • strand?: +
  • coordinates?: 3180064..3180927
  • synteny block?: BlockID0019140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0741
    08BA02176:
    C248_0850
    11819-97:
    MS7_0813
    71193:
    ST398NM01_0839
    ECT-R 2:
    ECTR2_713
    ED133:
    SAOV_0800
    ED98:
    SAAV_0726
    HO 5096 0412:
    SAEMRSA15_06890
    JH1:
    SaurJH1_0804
    JH9:
    SaurJH9_0787
    JKD6008:
    SAA6008_00778
    JKD6159:
    SAA6159_00720
    LGA251:
    SARLGA251_06960
    M013:
    M013TW_0750
    MRSA252:
    SAR0817
    MSHR1132:
    SAMSHR1132_07080
    MSSA476:
    SAS0728
    Mu3:
    SAHV_0760
    Mu50:
    SAV0763
    MW2:
    MW0725
    RF122:
    SAB0716
    ST398:
    SAPIG0839
    T0131:
    SAT0131_00835
    TCH60:
    HMPREF0772_12418
    TW20:
    SATW20_08380
    USA300_TCH1516:
    USA300HOU_0791
    VC40:
    SAVC_03450

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAQKNNNVIPMTFDDAFYRKMAKQKFKQREYKRAAEYFEKVLELSPDDMEIQIDYAQCLV
    N315            MAQKNNNVIPMTFDDAFYRKMAKQKFKQREYKRAAEYFEKVLELSPDDLEIQIDYAQCLV
    NCTC8325        MAQKNNNVIPMTFDDAFYRKMAKQKFKQREYKRAAEYFEKVLELSPDDLEIQIDYAQCLV
    Newman          MAQKNNNVIPMTFDDAFYRKMAKQKFKQREYKRAAEYFEKVLELSPDDMEIQIDYAQCLV
    USA300_FPR3757  MAQKNNNVIPMTFDDAFYRKMAKQKFKQREYKRAAEYFEKVLELSPDDMEIQIDYAQCLV
                    ************************************************:***********

    COL             QLGIAKKAEHLFYDNIIYNRHLEDSFYELSQLNIEVNEPNKAFLFGINYVIVSDDQDYRD
    N315            QLGIAKKAEHLFYDNIIYNRHLEDSFYELSQLNIEVNEPNKAFLFGINYVIVSDDQDYRD
    NCTC8325        QLGIAKKAEHLFYDNIIYNRHLEDSFYELSQLNIEVNEPNKAFLFGINYVIVSDDQDYRD
    Newman          QLGIAKKAEHLFYDNIIYNRHLEDSFYELSQLNIEVNEPNKAFLFGINYVIVSDDQDYRD
    USA300_FPR3757  QLGIAKKAEHLFYDNIIYNRHLEDSFYELSQLNIEVNEPNKAFLFGINYVIVSDDQDYRD
                    ************************************************************

    COL             ELDQMFDVKYQSEEQIELEAQLFVVQILFQYLFSQGRLKDAKNYVLHQPQEVQDHRVVRN
    N315            ELDQMFDVKYQSEEQIELEAQLFVVQILFQYLFSQGRLKDAKNYVLHQPQEVQDHRVVRN
    NCTC8325        ELDQMFDVKYQSEEQIELEAQLFVVQILFQYLFSQGRLKDAKNYVLHQPQEVQDHRVVRN
    Newman          ELDQMFDVKYQSEEQIELEAQLFVVQILFQYLFSQGRLKDAKNYVLHQPQEVQDHRVVRN
    USA300_FPR3757  ELDQMFDVKYQSEEQIELEAQLFVVQILFQYLFSQGRLKDAKNYVLHQPQEVQDHRVVRN
                    ************************************************************

    COL             LLAMCYLYLGEYDRAKALYEALLQEDSTDIYALCHYTLLLYNTKENEQYQKYLKILNKVV
    N315            LLAMCYLYLGEYDTAKALYEALLQEDSTDIYALCHYTLLLYNTKENEQYQKYLKILNKVV
    NCTC8325        LLAMCYLYLGEYDTAKALYEALLQEDSTDIYALCHYTLLLYNTKENEQYQKYLKILNKVV
    Newman          LLAMCYLYLGEYDRAKALYEALLQEDSTDIYALCHYTLLLYNTKENEQYQKYLKILNKVV
    USA300_FPR3757  LLAMCYLYLGEYDTAKALYEALLQEDSTDIYALCHYTLLLYNTKENEQYQKYLKILNKVV
                    ************* **********************************************

    COL             PMNDDESFKLGIVLSYLKQYRASQQLLYPLYKKGKFLSIQMYNALAYNYYYLGEEDESHY
    N315            PMNDDESFKLGIVLSYLKQYRASQQLLYPLYKKGKFLSIQMYNALAYNYYYLGEEDESHY
    NCTC8325        PMNDDESFKLGIVLSYLKQYRASQQLLYPLYKKGKFLSIQMYNALAYNYYYLGEEDESHY
    Newman          PMNDDESFKLGIVLSYLKQYRASQQLLYPLYKKGKFLSIQMYNALAYNYYYLGEEDESHY
    USA300_FPR3757  PMNDDESFKLGIVLSYLKQYRASQQLLYPLYKKGKFLSIQMYNALAYNYYYLGEEDESHY
                    ************************************************************

    COL             YWDKLKQISKVEIGHAPWVIENSKEVFDQHILPLLQSDDSHYRLYGIFLLDQLNGKEIVM
    N315            YWDKLKQISKVEIGHAPWVIENSKEVFDQHILPLLQSDDSHYRLYGIFLLDQLNGKEIVM
    NCTC8325        YWDKLKQISKVEIGHAPWVIENSKEVFDQHILPLLQSDDSHYRLYGIFLLDQLNGKEIVM
    Newman          YWDKLKQISKVEIGHAPWVIENSKEVFDQHILPLLQSDDSHYRLYGIFLLDQLNGKEIVM
    USA300_FPR3757  YWDKLKQISKVEIGHAPWVIENSKEVFDQHILPLLQSDDSHYRLYGIFLLDQLNGKEIVM
                    ************************************************************

    COL             TESIWQVLENLNNYEKLYLTYLVQGLTLNKLDFIHRGLLTLYHNELFVSENDVMVAWINQ
    N315            TESIWQVLENLNNYEKLYLTYLVQGLTLNKLDFIHRGLLTLYQNELFVSENDLMVAWINQ
    NCTC8325        TESIWQVLENLNNYEKLYLTYLVQGLTLNKLDFIHRGLLTLYHNELFVSENDVMVAWINQ
    Newman          TESIWQVLENLNNYEKLYLTYLVQGLTLNKLDFIHRGLLTLYHNELFVSENDVMVAWINQ
    USA300_FPR3757  TESIWQVLENLNNYEKLYLTYLVQGLTLNKLDFIHRGLLTLYHNELFVSENDVMVAWINQ
                    ******************************************:*********:*******

    COL             GELIIAEKVDLTDVEPYIGAFIYLYFKNQPRNVTKKQITTWLGITQYKLNKMIEFLLSI
    N315            GELIIAEKVDLTDVEPYIGAFIYLYFKNQPRNVTKKQITTWLGITQYKLNKMIEFLLSI
    NCTC8325        GELIIAEKVDLTDVEPYIGAFIYLYFKNQPRNVTKKQITTWLGITQYKLNKMIEFLLSI
    Newman          GELIIAEKVDLTDVEPYIGAFIYLYFKNQPRNVTKKQITTWLGITQYKLNKMIEFLLSI
    USA300_FPR3757  GELIIAEKVDLTDVEPYIGAFIYLYFKNQPRNVTKKQITTWLGITQYKLNKMIEFLLSI
                    ***********************************************************