From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002705000
  • symbol?: gapR
  • description?: glycolytic operon regulator

      descriptions from strain specific annotations:

    • glycolytic operon regulator
    • DeoR family transcriptional regulator
    • sugar-binding domain-containing protein
    • Central glycolytic genes regulator
    • putative sugar-binding domain protein
  • strand?: +
  • coordinates?: 3193814..3194830
  • synteny block?: BlockID0019370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0837 (gapR)
    N315:
    SA0726 (gapR)
    NCTC8325:
    Newman:
    NWMN_0740 (gapR)
    USA300_FPR3757:
    04-02981:
    SA2981_0749 (gapR)
    08BA02176:
    C248_0862 (gapR)
    11819-97:
    MS7_0822
    71193:
    ST398NM01_0850
    ECT-R 2:
    ECTR2_722
    ED133:
    SAOV_0813
    ED98:
    SAAV_0737 (gapR)
    HO 5096 0412:
    SAEMRSA15_06980 (gapR)
    JH1:
    SaurJH1_0812
    JH9:
    SaurJH9_0796
    JKD6008:
    SAA6008_00786
    JKD6159:
    SAA6159_00728
    LGA251:
    SARLGA251_07050 (gapR)
    M013:
    M013TW_0762
    MRSA252:
    SAR0827 (gapR)
    MSHR1132:
    SAMSHR1132_07170
    MSSA476:
    SAS0737
    Mu3:
    SAHV_0768 (gapR)
    Mu50:
    SAV0771 (gapR)
    MW2:
    MW0733 (gapR)
    RF122:
    SAB0727 (gapR)
    ST398:
    SAPIG0850
    T0131:
    SAT0131_00843
    TCH60:
    HMPREF0772_12407 (cggR)
    TW20:
    SATW20_08460 (gapR)
    USA300_TCH1516:
    USA300HOU_0801
    VC40:
    SAVC_03500

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKDLLQAQQKLIPDLIDKMYKRFSILTTISKNQPVGRRSLSEHMDMTERVLRSETDMLKK
    N315            MKDLLQAQQKLIPDLIDKMYKRFSILTTISKNQPVGRRSLSEHMDMTERVLRSETDMLKK
    NCTC8325        MKDLLQAQQKLIPDLIDKMYKRFSILTTISKNQPVGRRSLSEHMDMTERVLRSETDMLKK
    Newman          MKDLLQAQQKLIPDLIDKMYKRFSILTTISKNQPVGRRSLSEHMDMTERVLRSETDMLKK
    USA300_FPR3757  MKDLLQAQQKLIPDLIDKMYKRFSILTTISKNQPVGRRSLSEHMDMTERVLRSETDMLKK
                    ************************************************************

    COL             QDLIKVKPTGMEITAEGEQLISQLKGYFDIYADDNRLSEGIKNKFQIKEVHVVPGDADNS
    N315            QDLIKVKPTGMEITAEGEQLISQLKGYFDIYADDNRLSEGIKNKFQIKEVHVVPGDADNS
    NCTC8325        QDLIKVKPTGMEITAEGEQLISQLKGYFDIYADDNRLSEGIKNKFQIKEVHVVPGDADNS
    Newman          QDLIKVKPTGMEITAEGEQLISQLKGYFDIYADDNRLSEGIKNKFQIKEVHVVPGDADNS
    USA300_FPR3757  QDLIKVKPTGMEITAEGEQLISQLKGYFDIYADDNRLSEGIKNKFQIKEVHVVPGDADNS
                    ************************************************************

    COL             QSVKTELGRQAGQLLEGILQEDAIVAVTGGSTMACVSEAIHLLPYNVFFVPARGGLGENV
    N315            QSVKTELGRQAGQLLEGILQEDAIVAVTGGSTMACVSEAIHLLPYNVFFVPARGGLGENV
    NCTC8325        QSVKTELGRQAGQLLEGILQEDAIVAVTGGSTMACVSEAIHLLPYNVFFVPARGGLGENV
    Newman          QSVKTELGRQAGQLLEGILQEDAIVAVTGGSTMACVSEAIHLLPYNVFFVPARGGLGENV
    USA300_FPR3757  QSVKTELGRQAGQLLEGILQEDAIVAVTGGSTMACVSEAIHLLPYNVFFVPARGGLGENV
                    ************************************************************

    COL             VFQANTIAASMAQQAGGYYTTMYVPDNVSETTYNTLLLEPSVINTLDKIKQANVILHGIG
    N315            VFQANTIAASMAQQAGGYYTTMYVPDNVSETTYNTLLLEPSVINTLDKIKQANVILHGIG
    NCTC8325        VFQANTIAASMAQQAGGYYTTMYVPDNVSETTYNTLLLEPSVINTLDKIKQANVILHGIG
    Newman          VFQANTIAASMAQQAGGYYTTMYVPDNVSETTYNTLLLEPSVINTLDKIKQANVILHGIG
    USA300_FPR3757  VFQANTIAASMAQQAGGYYTTMYVPDNVSETTYNTLLLEPSVINTLDKIKQANVILHGIG
                    ************************************************************

    COL             DALKMAHRRQSPEKVIEQLQHHQAVGEAFGYYFDTQGQIVHKVKTIGLQLEDLESKDFIF
    N315            DALKMAHRRQSPEKVIEQLQHHQAVGEAFGYYFDTQGQIVHKVKTIGLQLEDLESKDFIF
    NCTC8325        DALKMAHRRQSPEKVIEQLQHHQAVGEAFGYYFDTQGQIVHKVKTIGLQLEDLESKDFIF
    Newman          DALKMAHRRQSPEKVIEQLQHHQAVGEAFGYYFDTQGQIVHKVKTIGLQLEDLESKDFIF
    USA300_FPR3757  DALKMAHRRQSPEKVIEQLQHHQAVGEAFGYYFDTQGQIVHKVKTIGLQLEDLESKDFIF
                    ************************************************************

    COL             AVAGGKSKGEAIKAYLTIAPKNTVLITDEAAAKIILE
    N315            AVAGGKSKGEAIKAYLTIAPKNTVLITDEAAAKIILE
    NCTC8325        AVAGGKSKGEAIKAYLTIAPKNTVLITDEAAAKIILE
    Newman          AVAGGKSKGEAIKAYLTIAPKNTVLITDEAAAKIILE
    USA300_FPR3757  AVAGGKSKGEAIKAYLTIAPKNTVLITDEAAAKIILE
                    *************************************