Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002712000
  • symbol?: secG
  • description?: preprotein translocase subunit SecG

      descriptions from strain specific annotations:

    • preprotein translocase subunit SecG
    • protein-export membrane protein secG
    • putative protein-export membrane protein
    • preprotein translocase, SecG subunit
    • protein-export translocase membrane protein
  • strand?: +
  • coordinates?: 3201902..3202177
  • synteny block?: BlockID0019440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0844 (secG)
    N315:
    SA0733 (secG)
    NCTC8325:
    Newman:
    NWMN_0747 (secG)
    USA300_FPR3757:
    04-02981:
    SA2981_0756 (secG)
    08BA02176:
    C248_0869 (secG)
    11819-97:
    MS7_0829 (secG)
    71193:
    ST398NM01_0857
    ECT-R 2:
    ECTR2_729 (secG)
    ED133:
    SAOV_0820
    ED98:
    SAAV_0744 (secG)
    HO 5096 0412:
    SAEMRSA15_07050 (secG)
    JH1:
    SaurJH1_0819 (secG)
    JH9:
    SaurJH9_0803 (secG)
    JKD6008:
    SAA6008_00793 (secG)
    JKD6159:
    SAA6159_00735 (secG)
    LGA251:
    SARLGA251_07120 (secG)
    M013:
    M013TW_0769
    MRSA252:
    SAR0834 (secG)
    MSHR1132:
    SAMSHR1132_07240
    MSSA476:
    SAS0744 (secG)
    Mu3:
    SAHV_0775 (secG)
    Mu50:
    SAV0778 (secG)
    MW2:
    MW0740 (secG)
    RF122:
    SAB0734 (secG)
    ST398:
    SAPIG0857 (secG)
    T0131:
    SAT0131_00851
    TCH60:
    HMPREF0772_12400 (secG)
    TW20:
    SATW20_08530 (secG)
    USA300_TCH1516:
    USA300HOU_0808 (secG)
    VC40:
    SAVC_03535 (secG)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII
    N315            MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII
    NCTC8325        MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII
    Newman          MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII
    USA300_FPR3757  MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII
                    ************************************************************

    COL             LSILFFVLMICISYLGM
    N315            LSILFFVLMICISYLGM
    NCTC8325        LSILFFVLMICISYLGM
    Newman          LSILFFVLMICISYLGM
    USA300_FPR3757  LSILFFVLMICISYLGM
                    *****************