From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002715000
  • symbol?: smpB
  • description?: SsrA-binding protein

      descriptions from strain specific annotations:

    • SsrA-binding protein
    • putative tmRNA-binding protein
    • SsrA (tmRNA)-binding protein
    • tmRNA and SsrA-binding protein
    • tmRNA-binding protein SmpB
  • strand?: +
  • coordinates?: 3205474..3205938
  • synteny block?: BlockID0019470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0847 (smpB)
    N315:
    SA0736 (smpB)
    NCTC8325:
    Newman:
    NWMN_0750 (smpB)
    USA300_FPR3757:
    04-02981:
    SA2981_0759 (smpB)
    08BA02176:
    C248_0872 (smpB)
    11819-97:
    MS7_0832 (smpB)
    71193:
    ST398NM01_0860
    ECT-R 2:
    ECTR2_732 (smpB)
    ED133:
    SAOV_0823
    ED98:
    SAAV_0747 (smpB)
    HO 5096 0412:
    SAEMRSA15_07080 (smpB)
    JH1:
    SaurJH1_0822 (smpB)
    JH9:
    SaurJH9_0806 (smpB)
    JKD6008:
    SAA6008_00796 (smpB)
    JKD6159:
    SAA6159_00738 (smpB)
    LGA251:
    SARLGA251_07150 (smpB)
    M013:
    M013TW_0772
    MRSA252:
    SAR0837 (smpB)
    MSHR1132:
    SAMSHR1132_07270
    MSSA476:
    SAS0747 (smpB)
    Mu3:
    SAHV_0778 (smpB)
    Mu50:
    SAV0782 (smpB)
    MW2:
    MW0743 (smpB)
    RF122:
    SAB0737 (smpB)
    ST398:
    SAPIG0860 (smpB)
    T0131:
    SAT0131_00854
    TCH60:
    HMPREF0772_12397 (smpB)
    TW20:
    SATW20_08560 (smpB)
    USA300_TCH1516:
    USA300HOU_0811 (smpB)
    VC40:
    SAVC_03550 (smpB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKKKSPGTLAENRKARHDYNIEDTIEAGIVLQGTEIKSIRRGSANLKDSYAQVKNGEMY
    N315            MAKKKSPGTLAENRKARHDYNIEDTIEAGIVLQGTEIKSIRRGSANLKDSYAQVKNGEMY
    NCTC8325        MAKKKSPGTLAENRKARHDYNIEDTIEAGIVLQGTEIKSIRRGSANLKDSYAQVKNGEMY
    Newman          MAKKKSPGTLAENRKARHDYNIEDTIEAGIVLQGTEIKSIRRGSANLKDSYAQVKNGEMY
    USA300_FPR3757  MAKKKSPGTLAENRKARHDYNIEDTIEAGIVLQGTEIKSIRRGSANLKDSYAQVKNGEMY
                    ************************************************************

    COL             LNNMHIAPYEEGNRFNHDPLRSRKLLLHKREIIKLGDQTREIGYSIVPLKLYLKHGHCKV
    N315            LNNMHIAPYEEGNRFNHDPLRSRKLLLHKREIFKLGEQTREIGYSIVPLKLYLKHGHCKV
    NCTC8325        LNNMHIAPYEEGNRFNHDPLRSRKLLLHKREIIKLGDQTREIGYSIVPLKLYLKHGHCKV
    Newman          LNNMHIAPYEEGNRFNHDPLRSRKLLLHKREIIKLGDQTREIGYSIVPLKLYLKHGHCKV
    USA300_FPR3757  LNNMHIAPYEEGNRFNHDPLRSRKLLLHKREIIKLGDQTREIGYSIVPLKLYLKHGHCKV
                    ********************************:***:***********************

    COL             LLGVARGKKKYDKRQALKEKAVKRDVARDMKARY
    N315            LLGVARGKKKYDKRQALKEKAVKRDVARDMKARY
    NCTC8325        LLGVARGKKKYDKRQALKEKAVKRDVARDMKARY
    Newman          LLGVARGKKKYDKRQALKEKAVKRDVARDMKARY
    USA300_FPR3757  LLGVARGKKKYDKRQALKEKAVKRDVARDMKARY
                    **********************************