From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002791000
  • symbol?: vwb
  • description?: coagulase

      descriptions from strain specific annotations:

    • coagulase
    • staphylocoagulase precursor
    • truncated secreted von Willebrand factor-binding protein (coagulase) VWbp
    • secreted von Willebrand factor-binding protein precursor
    • putative staphylocoagulase
    • pseudogene
    • putative secreted von Willebrand factor-binding protein
    • secreted von Willebrand factor-binding protein
    • secreted von Willebrand factor-binding protein-like protein
    • Secreted von Willebrand factor-binding protein VWbp hypothetical protein
    • staphylocoagulase precursor (cell-bound form of staphylocoagulase)
    • staphylocoagulase precursor, Coa_1
    • Staphylococcus aureus subsp. aureus ECT-R 2 coagulase family protein
    • truncated secreted von Willebrand factor-binding protein VWbp
  • strand?: +
  • coordinates?: 3260483..3262576
  • synteny block?: BlockID0019850
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0767
    08BA02176:
    11819-97:
    MS7_0840
    71193:
    ECT-R 2:
    ECTR2_740
    ED133:
    SAOV_0829
    ED98:
    SAAV_0758
    HO 5096 0412:
    JH1:
    SaurJH1_0829
    JH9:
    SaurJH9_0813
    JKD6008:
    SAA6008_00804
    JKD6159:
    SAA6159_00744 (coa_1)
    LGA251:
    SARLGA251_07200
    M013:
    MRSA252:
    SAR0843
    MSHR1132:
    MSSA476:
    SAS0753
    Mu3:
    SAHV_0808 (graB)
    Mu50:
    SAV0812
    MW2:
    MW0766
    RF122:
    ST398:
    T0131:
    SAT0131_00888
    TCH60:
    HMPREF0772_12390
    TW20:
    SATW20_08630
    USA300_TCH1516:
    USA300HOU_0820 (vwb)
    VC40:
    SAVC_03590

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNKLLVLSLGALCVSQIWESNRASAVVSGEKNPYVSESLKLTNNKNKSRTVEEYKKSLD
    N315            MKNKLLVLSLGALCVSQIWESNHASAVVSGEKNPYVSKALELKDKSNKSNSYENYRDSLE
    NCTC8325        ----------------------------------------------------------MD
    Newman          MKNKLLVLSLGALCVSQIWESNRASAVVSGEKNPYVSESLKLTNNKNKSRTVEEYKKSLD
    USA300_FPR3757  MKNKLLVLSLGALCVSQIWESNRASAVVSGEKNPYVSESLKLTNNKNKSRTVEEYKKSLD
                                                                              ::

    COL             DLIWSFPNLDNERFDNPEYKEAMKKYQQRFMAEDEALKKFFSEEKKIKNGNTD--NLDYL
    N315            SLISSLSFADYEKYEEPEYEKAVKKYQQKFMAEDDALKNFLNEEKKIKNADISRKSNNLL
    NCTC8325        DLIWSFPNLDNERFDNPEYKEAMKKYQQRFMAEDEALKKFFSEEKKIKNGNTD--NLDYL
    Newman          DLIWSFPNLDNERFDNPEYKEAMKKYQQRFMAEDEALKKFFSEEKKIKNGNTD--NLDYL
    USA300_FPR3757  DLIWSFPNLDNERFDNPEYKEAMKKYQQRFMAEDEALKKFFSEEKKIKNGNTD--NLDYL
                    .** *:.  * *::::***::*:*****:*****:***:*:.*******.: .  . : *

    COL             GLSHERYESVFNTLKKQSEEFLKEIEDIKKDNPELKDFNEEEQLKCDLELNKLENQILML
    N315            GLTHERYSYIFDTLKKNKQEFLKDIEEIQLKNSDLKDFNNTEQHNADVEINNLENKVLMV
    NCTC8325        GLSHERYESVFNTLKKQSEEFLKEIEDIKKDNPELKDFNEEEQLKCDLELNKLENQILML
    Newman          GLSHERYESVFNTLKKQSEEFLKEIEDIKKDNPELKDFNEEEQLKCDLELNKLENQILML
    USA300_FPR3757  GLSHERYESVFNTLKKQSEEFLKEIEDIKKDNPELKDFNEEEQLKCDLELNKLENQILML
                    **:****. :*:****:.:****:**:*: .*.:*****: ** :.*:*:*:***::**:

    COL             GKTFYQNYRDDVESLYSKLDLIMGYKDEERANKKAVNKRMLENKKEDLETIIDEFFSDID
    N315            GYTFYNTNKDEVEELYSELDLIVGEVQDKSDKKRAVNQRMLNRKKEDLEFIIDKFFKKIQ
    NCTC8325        GKTFYQNYRDDVESLYSKLDLIMGYKDEERANKKAVNKRMLENKKEDLETIIDEFFSDID
    Newman          GKTFYQNYRDDVESLYSKLDLIMGYKDEERANKKAVNKRMLENKKEDLETIIDEFFSDID
    USA300_FPR3757  GKTFYQNYRDDVESLYSKLDLIMGYKDEERANKKAVNKRMLENKKEDLETIIDEFFSDID
                    * ***:. :*:**.***:****:*  :::  :*:***:***:.****** ***:**..*:

    COL             KTRPNNIPVLEDEKQEEKNHKNMAQLKSDTEAAKSDESKRSKRSKRSLNTQNHKPASQEV
    N315            QERPESIPALTSEKNH--NQTMALKLKADTEAAKND---VSKRSKRSLNTQNNKSTTQEI
    NCTC8325        KTRPNNIPVLEDEKQEEKNHKNMAQLKSDTEAAKSDESKRSKRSKRSLNTQNHKPASQEV
    Newman          KTRPNNIPVLEDEKQEEKNHKNMAQLKSDTEAAKSDESKRSKRSKRSLNTQNHKPASQEV
    USA300_FPR3757  KTRPNNIPVLEDEKQEEKNHKNMAQLKSDTEAAKSDESKRSKRSKRSLNTQNHKPASQEV
                    : **:.**.* .**:.  *:.   :**:******.*    ************:*.::**:

    COL             SEQQKAEYDKRAEERKARFLDNQKIKKTPVVSLEYDFEHKQRIDNENDKKLVVSAPTKKP
    N315            SEEQKAEYQRKSEALKERFINRQKSKNESVVSLIDDED-----DNENDRQLVVSAPSKKP
    NCTC8325        SEQQKAEYDKRAEERKARFLDNQKIKKTPVVSLEYDFEHKQRIDNENDKKLVVSAPTKKP
    Newman          SEQQKAEYDKRAEERKARFLDNQKIKKTPVVSLEYDFEHKQRIDNENDKKLVVSAPTKKP
    USA300_FPR3757  SEQQKAEYDKRAEERKARFLDNQKIKKTPVVSLEYDFEHKQRIDNENDKKLVVSAPTKKP
                    **:*****::::*  * **::.** *: .****  * :     *****::******:***

    COL             TSPTTYTETTTQVPMPTVERQTQQQIIYNAPKQLAGLNGESHDFTTTHQSPTTSNHTHNN
    N315            TTPTTYTETTTQVPMPTVERQTQQQIVYKTPKPLAGLNGESHDFTTTHQSPTTSNHTHNN
    NCTC8325        TSPTTYTETTTQVPMPTVERQTQQQIIYNAPKQLAGLNGESHDFTTTHQSPTTSNHTHNN
    Newman          TSPTTYTETTTQVPMPTVERQTQQQIIYNAPKQLAGLNGESHDFTTTHQSPTTSNHTHNN
    USA300_FPR3757  TSPTTYTETTTQVPMPTVERQTQQQIIYNAPKQLAGLNGESHDFTTTHQSPTTSNHTHNN
                    *:************************:*::** ***************************

    COL             VVEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTHSYKD
    N315            VVEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTHSYKD
    NCTC8325        VVEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTHSYKD
    Newman          VVEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTHSYKD
    USA300_FPR3757  VVEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTHSYKD
                    ************************************************************

    COL             RINAQQKVNTLSEGHQKRFNKQINKVYNGK
    N315            RLNAQQKVNTLSEGHQKRFNKQINKVYNGK
    NCTC8325        RINAQQKVNTLSEGHQKRFNKQINKVYNGK
    Newman          RINAQQKVNTLSEGHQKRFNKQINKVYNGK
    USA300_FPR3757  RINAQQKVNTLSEGHQKRFNKQINKVYNGK
                    *:****************************