From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002803000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3270884..3271102
  • synteny block?: BlockID0019940
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0772
    08BA02176:
    C248_0887
    11819-97:
    MS7_0845
    71193:
    ST398NM01_2847
    ECT-R 2:
    ECTR2_745
    ED133:
    SAOV_0834c
    ED98:
    SAAV_0763
    HO 5096 0412:
    SAEMRSA15_07200
    JH1:
    SaurJH1_0834
    JH9:
    SaurJH9_0818
    JKD6008:
    SAA6008_00809
    JKD6159:
    SAA6159_00749
    LGA251:
    SARLGA251_07250
    M013:
    M013TW_0784
    MRSA252:
    SAR0849
    MSHR1132:
    SAMSHR1132_07420
    MSSA476:
    SAS0758
    Mu3:
    SAHV_0813
    Mu50:
    SAV0817
    MW2:
    MW0771
    RF122:
    SAB0750c
    ST398:
    T0131:
    SAT0131_00894 (lrgB)
    TCH60:
    HMPREF0772_12385
    TW20:
    SATW20_08680
    USA300_TCH1516:
    USA300HOU_0825
    VC40:
    SAVC_03615

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEWHINNQSTKPFLIQQAEKQLSIVKPLPNGSFQILTEINLENGNISNIDHSLLVSVDP
    N315            MSEWHINNQSTKPFLIQQAEKQLSIVKPLPNGSFQILTEINLENGNISNIDHSLLVSVDP
    NCTC8325        MSEWHINNQSTKPFLIQQAEKQLSIVKPLPNGSFQILTEINLENGNISNIDHSLLVSVDP
    Newman          MSEWHINNQSTKPFLIQQAEKQLSIVKPLPNGSFQILTEINLENGNISNIDHSLLVSVDP
    USA300_FPR3757  MSEWHINNQSTKPFLIQQAEKQLSIVKPLPNGSFQILTEINLENGNISNIDHSLLVSVDP
                    ************************************************************

    COL             KALEISIFDAVN
    N315            KALEISIFDAVN
    NCTC8325        KALEISIFDAVN
    Newman          KALEISIFDAVN
    USA300_FPR3757  KALEISIFDAVN
                    ************