From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002810000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3273665..3273901
  • synteny block?: BlockID0020010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0778
    08BA02176:
    C248_0892
    11819-97:
    MS7_0850
    71193:
    ST398NM01_0877
    ECT-R 2:
    ECTR2_749
    ED133:
    SAOV_0840c
    ED98:
    SAAV_0770
    HO 5096 0412:
    SAEMRSA15_07260
    JH1:
    SaurJH1_0840
    JH9:
    SaurJH9_0823
    JKD6008:
    SAA6008_00814
    JKD6159:
    SAA6159_00755
    LGA251:
    SARLGA251_07300
    M013:
    M013TW_0789
    MRSA252:
    SAR0855
    MSHR1132:
    SAMSHR1132_07480
    MSSA476:
    SAS0764
    Mu3:
    SAHV_0819
    Mu50:
    SAV0823
    MW2:
    MW0777
    RF122:
    SAB0755c
    ST398:
    SAPIG0877
    T0131:
    SAT0131_00898
    TCH60:
    HMPREF0772_12379
    TW20:
    SATW20_08730
    USA300_TCH1516:
    USA300HOU_0830
    VC40:
    SAVC_03645

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDNHNQCNYVNPQNVSLDWECFIISKSEMLLDGVPNELINTWLDKDIITPFSIRNDEINF
    N315            MDHHNQCNYVNPQNVSLDWECFIISKSEMLLDGVPNELINTWLDKDIITPFSIRNDEINF
    NCTC8325        MDNHNQCNYVNPQNVSLDWECFIISKSEMLLDGVPNELINTWLDKDIITPFSIRNDEINF
    Newman          MDNHNQCNYVNPQNVSLDWECFIISKSEMLLDGVPNELINTWLDKDIITPFSIRNDEINF
    USA300_FPR3757  MDNHNQCNYVNPQNVSLDWECFIISKSEMLLDGVPNELINTWLDKDIITPFSIRNDEINF
                    **:*********************************************************

    COL             KTKDIWDALIHHNWYYSN
    N315            KTKDIWDALIHHNWYYSN
    NCTC8325        KTKDIWDALIHHNWYYSN
    Newman          KTKDIWDALIHHNWYYSN
    USA300_FPR3757  KTKDIWDALIHHNWYYSN
                    ******************