From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002812000
  • symbol?:
  • description?: LysE/YggA family protein

      descriptions from strain specific annotations:

    • LysE/YggA family protein
    • amino acid transporter LysE
    • LysE family L-lysine exporter
    • LysE family transporter
    • lysE type translocator family protein
    • lysE type translocator protein
    • lysine exporter protein LysE/YggA
    • putative LysE type translocator protein
    • transporter, LysE family
  • strand?: -
  • coordinates?: 3274781..3275398
  • synteny block?: BlockID0020030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0780
    08BA02176:
    C248_0894
    11819-97:
    MS7_0852
    71193:
    ST398NM01_0880
    ECT-R 2:
    ECTR2_752
    ED133:
    SAOV_0842c
    ED98:
    SAAV_0772
    HO 5096 0412:
    SAEMRSA15_07280
    JH1:
    SaurJH1_0842
    JH9:
    SaurJH9_0825
    JKD6008:
    SAA6008_00816
    JKD6159:
    SAA6159_00757
    LGA251:
    SARLGA251_07320
    M013:
    M013TW_0791
    MRSA252:
    SAR0857
    MSHR1132:
    SAMSHR1132_07500
    MSSA476:
    SAS0766
    Mu3:
    SAHV_0821
    Mu50:
    SAV0825
    MW2:
    MW0779
    RF122:
    SAB0757c
    ST398:
    SAPIG0880
    T0131:
    SAT0131_00900 (bglA)
    TCH60:
    HMPREF0772_12377
    TW20:
    SATW20_08750
    USA300_TCH1516:
    USA300HOU_0832
    VC40:
    SAVC_03655

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVTAIIHGFILAIGLILPLGAQNVFIFNQGANQPKYRYVLPAIITAGLSDSLLIIIAVVG
    N315            MVTAIIHGFILAIGLILPLGAQNVFIFNQGANQPKYRYVLPAIITAGLSDSLLIIIAVVG
    NCTC8325        MVTAIIHGFILAIGLILPLGAQNVFIFNQGANQPKYRYVLPAIITAGLSDSLLIIIAVVG
    Newman          MVTAIIHGFILAIGLILPLGAQNVFIFNQGANQPKYRYVLPAIITAGLSDSLLIIIAVVG
    USA300_FPR3757  MVTAIIHGFILAIGLILPLGAQNVFIFNQGANQPKYRYVLPAIITAGLSDSLLIIIAVVG
                    ************************************************************

    COL             VSIIIMSLPVLQAIIYIVGLIFLMYMAWTIWHDKPSTDGETQIMSPMKQVSFALSVSLLN
    N315            VSIIIMSLPVLQAIIYIVGLIFLMYMAWTIWHDKPSTDGEAQIISPMKQVSFALSVSLLN
    NCTC8325        VSIIIMSLPVLQAIIYIVGLIFLMYMAWTIWHDKPSTDGETQIMSPMKQVSFALSVSLLN
    Newman          VSIIIMSLPVLQAIIYIVGLIFLMYMAWTIWHDKPSTDGETQIMSPMKQVSFALSVSLLN
    USA300_FPR3757  VSIIIMSLPVLQAIIYIVGLIFLMYMAWTIWHDKPSTDGETQIMSPMKQVSFALSVSLLN
                    ****************************************:**:****************

    COL             PHAILDTIGVIGSSAALYSGSNKIAFTIACISVSWLWFFLLAILGKMVGSIDKTGKLLTI
    N315            PHAILDTIGVIGSSAALYSGSNKIAFTIACISVSWLWFFLLAILGKMVGSIDKTGKLLTI
    NCTC8325        PHAILDTIGVIGSSAALYSGSNKIAFTIACISVSWLWFFLLAILGKMVGSIDKTGKLLTI
    Newman          PHAILDTIGVIGSSAALYSGSNKIAFTIACISVSWLWFFLLAILGKMVGSIDKTGKLLTI
    USA300_FPR3757  PHAILDTIGVIGSSAALYSGSNKIAFTIACISVSWLWFFLLAILGKMVGSIDKTGKLLTI
                    ************************************************************

    COL             INKISSIIIIIVALMILQKLIQLLF
    N315            INKISSIIIIIVALMILQKLIQLLF
    NCTC8325        INKISSIIIIIVALMILQKLIQLLF
    Newman          INKISSIIIIIVALMILQKLIQLLF
    USA300_FPR3757  INKISSIIIIIVALMILQKLIQLLF
                    *************************