From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002819000
  • symbol?:
  • description?: thioredoxin

      descriptions from strain specific annotations:

    • thioredoxin
    • thioredoxin domain-containing protein
    • thioredoxin, putative
    • putative thioredoxin
    • thioredoxin family protein
  • strand?: -
  • coordinates?: 3278557..3278879
  • synteny block?: BlockID0020100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0786
    08BA02176:
    C248_0899
    11819-97:
    MS7_0857
    71193:
    ST398NM01_0885
    ECT-R 2:
    ECTR2_757
    ED133:
    SAOV_0847c
    ED98:
    SAAV_0777
    HO 5096 0412:
    SAEMRSA15_07330
    JH1:
    SaurJH1_0847
    JH9:
    SaurJH9_0830
    JKD6008:
    SAA6008_00821
    JKD6159:
    SAA6159_00762
    LGA251:
    SARLGA251_07370
    M013:
    M013TW_0796
    MRSA252:
    SAR0862
    MSHR1132:
    SAMSHR1132_07550
    MSSA476:
    SAS0771
    Mu3:
    SAHV_0827
    Mu50:
    SAV0831
    MW2:
    MW0784
    RF122:
    SAB0762c
    ST398:
    SAPIG0885
    T0131:
    SAT0131_00905
    TCH60:
    HMPREF0772_12372
    TW20:
    SATW20_08800
    USA300_TCH1516:
    USA300HOU_0838
    VC40:
    SAVC_03680

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELE
    N315            MQAIKSNESFKSIINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELE
    NCTC8325        MQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELE
    Newman          MQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELE
    USA300_FPR3757  MQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELE
                    **:*********:***********************************************

    COL             DVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAETFK
    N315            DVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAETFK
    NCTC8325        DVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAETFK
    Newman          DVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAETFK
    USA300_FPR3757  DVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAETFK
                    **********************************************