From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002820000
  • symbol?:
  • description?: Arsenate reductase

      descriptions from strain specific annotations:

    • Arsenate reductase
    • ArsC family protein
    • putative arsenate Reductase (ArsC) family protein
    • Arsenate reductase-related protein
    • transcriptional regulator, Spx/MgsR family protein
    • arsenate reductase family protein
    • ArsC Glutaredoxin
  • strand?: +
  • coordinates?: 3279023..3279379
  • synteny block?: BlockID0020110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0787
    08BA02176:
    C248_0900 (arsC)
    11819-97:
    MS7_0858
    71193:
    ST398NM01_0886
    ECT-R 2:
    ECTR2_758
    ED133:
    SAOV_0848
    ED98:
    SAAV_0778
    HO 5096 0412:
    SAEMRSA15_07340
    JH1:
    SaurJH1_0848
    JH9:
    SaurJH9_0831
    JKD6008:
    SAA6008_00822 (arsC1)
    JKD6159:
    SAA6159_00763 (arsC1)
    LGA251:
    SARLGA251_07380
    M013:
    M013TW_0797
    MRSA252:
    SAR0863
    MSHR1132:
    SAMSHR1132_07560
    MSSA476:
    SAS0772
    Mu3:
    SAHV_0828
    Mu50:
    SAV0832
    MW2:
    MW0785
    RF122:
    SAB0763
    ST398:
    SAPIG0886
    T0131:
    SAT0131_00906
    TCH60:
    HMPREF0772_12371
    TW20:
    SATW20_08810
    USA300_TCH1516:
    USA300HOU_0839 (arsC1)
    VC40:
    SAVC_03685

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTH
    N315            MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTH
    NCTC8325        MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTH
    Newman          MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTH
    USA300_FPR3757  MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTH
                    ************************************************************

    COL             GAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA
    N315            GAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA
    NCTC8325        GAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA
    Newman          GAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA
    USA300_FPR3757  GAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA
                    **********************************************************