From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002835000
  • symbol?:
  • description?: TOPRIM domain-containing protein

      descriptions from strain specific annotations:

    • TOPRIM domain-containing protein
    • TOPRIM domain-containing topiosmerase/primase
    • topoisomerase/primase-like protein
    • putative small primase-like protein (Toprim domain)
    • TOPRIM domain protein
    • pseudogene
    • DNA primase/ small primase-like protein
    • TOPRIM domain topiosmerase/primase protein
  • strand?: +
  • coordinates?: 3288799..3289194
  • synteny block?: BlockID0020190
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0790
    08BA02176:
    C248_0904
    11819-97:
    MS7_0862
    71193:
    ST398NM01_0890
    ECT-R 2:
    ECTR2_762
    ED133:
    SAOV_0852
    ED98:
    SAAV_0781
    HO 5096 0412:
    SAEMRSA15_07370
    JH1:
    SaurJH1_0852
    JH9:
    SaurJH9_0836
    JKD6008:
    SAA6008_00833
    JKD6159:
    SAA6159_00766
    LGA251:
    SARLGA251_07410
    M013:
    M013TW_0801
    MRSA252:
    SAR0867
    MSHR1132:
    SAMSHR1132_07590
    MSSA476:
    SAS0776
    Mu3:
    SAHV_0831
    Mu50:
    SAV0835
    MW2:
    MW0788
    RF122:
    SAB0766
    ST398:
    SAPIG0890
    T0131:
    SAT0131_00910
    TCH60:
    HMPREF0772_12368
    TW20:
    SATW20_08840
    USA300_TCH1516:
    USA300HOU_0845
    VC40:
    SAVC_03710

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLA
    N315            ---MAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLA
    NCTC8325        ---MAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLA
    Newman          MMMMAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLA
    USA300_FPR3757  ---MAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLA
                       *********************************************************

    COL             DSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGFTCKKETPLLPN
    N315            DSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGFTCKKETPLLPN
    NCTC8325        DSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGFTCKKETPLLPN
    Newman          DSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGFTCKKETPLLPN
    USA300_FPR3757  DSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGFTCKKETPLLPN
                    ************************************************************

    COL             INNERLVLVNE
    N315            INNERLVLVNE
    NCTC8325        INNERLVLVNE
    Newman          INNERLVLVNE
    USA300_FPR3757  INNERLVLVNE
                    ***********