From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002838000
  • symbol?: metN1
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • Methionine ABC transporter ATP-binding protein
    • ABC transporter family protein
    • DL-methionine transporter ATP-binding subunit
    • Methionine import ATP-binding protein MetN 2
    • methionine ABC superfamily ATP binding cassette transporter, ABC protein
    • ATP-binding ABC transporter protein
  • strand?: +
  • coordinates?: 3289735..3290760
  • synteny block?: BlockID0020220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0792
    08BA02176:
    C248_0906
    11819-97:
    MS7_0864 (metN2)
    71193:
    ST398NM01_0892
    ECT-R 2:
    ECTR2_764
    ED133:
    SAOV_0854
    ED98:
    SAAV_0784
    HO 5096 0412:
    SAEMRSA15_07400
    JH1:
    SaurJH1_0854
    JH9:
    SaurJH9_0838
    JKD6008:
    SAA6008_00835
    JKD6159:
    SAA6159_00768
    LGA251:
    SARLGA251_07430
    M013:
    M013TW_0803
    MRSA252:
    SAR0870
    MSHR1132:
    SAMSHR1132_07610
    MSSA476:
    SAS0779
    Mu3:
    SAHV_0833
    Mu50:
    SAV0837
    MW2:
    MW0790
    RF122:
    SAB0768
    ST398:
    SAPIG0892
    T0131:
    SAT0131_00912 (agrC)
    TCH60:
    HMPREF0772_12366 (metN2)
    TW20:
    SATW20_08860
    USA300_TCH1516:
    USA300HOU_0847
    VC40:
    SAVC_03720

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIELKEVVKEYRTKNKEVLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSG
    N315            MIELKEVVKEYRTKNKEVLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSG
    NCTC8325        MIELKEVVKEYRTKNKEVLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSG
    Newman          MIELKEVVKEYRTKNKEVLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSG
    USA300_FPR3757  MIELKEVVKEYRTKNKEVLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSG
                    ************************************************************

    COL             EVIIDGDHIGQLSKNGLRAKRQKVSMIFQHFNLLWSRTVLKNIMFPLEIAGVPRRRAKQK
    N315            EVIIDGDHIGQLSKNGLRAKRQKVNMIFQHFNLLWSRTVLKNIMFPLEIAGVPRRRAKQK
    NCTC8325        EVIIDGDHIGQLSKNGLRAKRQKVSMIFQHFNLLWSRTVLKNIMFPLEIAGVPRRRAKQK
    Newman          EVIIDGDHIGQLSKNGLRAKRQKVSMIFQHFNLLWSRTVLKNIMFPLEIAGVPRRRAKQK
    USA300_FPR3757  EVIIDGDHIGQLSKNGLRAKRQKVSMIFQHFNLLWSRTVLKNIMFPLEIAGVPRRRAKQK
                    ************************.***********************************

    COL             ALELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEIL
    N315            ALELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEIL
    NCTC8325        ALELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEIL
    Newman          ALELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEIL
    USA300_FPR3757  ALELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEIL
                    ************************************************************

    COL             DLLLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEQGPVTQVFENPQHTVTKRF
    N315            DLLLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEHGPVTQVFENPQHTVTKRF
    NCTC8325        DLLLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEQGPVTQVFENPQHTVTKRF
    Newman          DLLLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEQGPVTQVFENPQHTVTKRF
    USA300_FPR3757  DLLLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEQGPVTQVFENPQHTVTKRF
                    *****************************************:******************

    COL             VKDDLNDDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSLSTAYDIKINILEANIKN
    N315            VKEDLNDDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSLSTAYDIKINILEANIKN
    NCTC8325        VKDDLNDDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSLSTAYDIKINILEANIKN
    Newman          VKDDLNDDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSLSTAYDIKINILEANIKN
    USA300_FPR3757  VKDDLNDDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSLSTAYDIKINILEANIKN
                    **:*********************************************************

    COL             TKNGTVGFLVLHIPYISSVDFGKFEKELIERQVKMEVLRHG
    N315            TKNGTVGFLVLHIPYISSVDFGKFEKELIERQVKMEVLRHG
    NCTC8325        TKNGTVGFLVLHIPYISSVDFGKFEKELIERQVKMEVLRHG
    Newman          TKNGTVGFLVLHIPYISSVDFGKFEKELIERQVKMEVLRHG
    USA300_FPR3757  TKNGTVGFLVLHIPYISSVDFGKFEKELIERQVKMEVLRHG
                    *****************************************