From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN002880000
  • symbol?: ear
  • description?: Secreted protein Ear, superantigen-encodingpathogenicity islands SaPI

      descriptions from strain specific annotations:

    • Secreted protein Ear, superantigen-encodingpathogenicity islands SaPI
    • Ear protein
  • strand?: -
  • coordinates?: 3327358..3327915
  • synteny block?: BlockID0020510
  • occurrence?: in 16% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    M013TW_0829
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_12340 (ear)
    TW20:
    USA300_TCH1516:
    USA300HOU_0867 (ear)
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKKLLTRTLIASALVLTTVGSGFHSSSNYNGINNVAKASEITDRDLWKNVRDALKEANI
    USA300_FPR3757  MNKKLLTKTLIASALVLTTVGSGFHSSSNYNGINNVAKAEQTTDNELWKNVRDALKEANI
                    *******:*******************************.: **.:**************

    COL             IDKTANETVGVTYNLNNGGESSITGTADLDELSNFNNKPINTDSVKRIDLSRINPNGNRF
    USA300_FPR3757  IDKTDNENVKVTYKLANGGENSIEGTANLNELSNSNNKPINSDSVKSIDLSRKNPNGDRF
                    **** **.* ***:* ****.** ***:*:**** ******:**** ***** ****:**

    COL             DANDAWKKLTDKLKEKQIVKNGDTVTIHSKDKNDPPISAKVGENYNGNKGLMLNQRDITK
    USA300_FPR3757  DANDAWKKLTDKLKEKQIVKDGDTVTIHSKDEKDPKISAKVGEVYNDNKRLMLFKKDIDK
                    ********************:**********::** ******* **.** *** ::** *

    COL             ITITK
    USA300_FPR3757  ITIN-
                    ***.