From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002892000
  • symbol?:
  • description?: sigmaB-controlled protein

      descriptions from strain specific annotations:

    • sigmaB-controlled protein
    • CsbD-like superfamily protein
    • CsbD family protein
    • putative CsbD family general stress response protein
    • csbD-like family protein
  • strand?: +
  • coordinates?: 3337823..3338017
  • synteny block?: BlockID0020580
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0795
    08BA02176:
    C248_0909
    11819-97:
    MS7_0867
    71193:
    ST398NM01_0895
    ECT-R 2:
    ECTR2_767
    ED133:
    SAOV_0857
    ED98:
    SAAV_0811
    HO 5096 0412:
    JH1:
    SaurJH1_0857
    JH9:
    SaurJH9_0841
    JKD6008:
    SAA6008_00862
    JKD6159:
    SAA6159_00771
    LGA251:
    SARLGA251_07690
    M013:
    M013TW_0832
    MRSA252:
    SAR0874
    MSHR1132:
    SAMSHR1132_07640
    MSSA476:
    SAS0782
    Mu3:
    SAHV_0836
    Mu50:
    SAV0840
    MW2:
    MW0793
    RF122:
    SAB0772
    ST398:
    SAPIG0895
    T0131:
    SAT0131_00939 (leuB)
    TCH60:
    HMPREF0772_12336
    TW20:
    SATW20_09120
    USA300_TCH1516:
    USA300HOU_0868
    VC40:
    SAVC_03735

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKG
    N315            MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKG
    NCTC8325        MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKG
    Newman          MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKG
    USA300_FPR3757  MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKG
                    ************************************************************

    COL             NKGE
    N315            NKGE
    NCTC8325        NKGE
    Newman          NKGE
    USA300_FPR3757  NKGE
                    ****