From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002894000
  • symbol?: sufC
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • FeS assembly ATPase SufC
    • Iron-sulfur cluster assembly ATPase protein SufC
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ATP-binding ABC transporter protein
  • strand?: +
  • coordinates?: 3339447..3340208
  • synteny block?: BlockID0020600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0785 (sufC)
    USA300_FPR3757:
    04-02981:
    SA2981_0797 (sufC)
    08BA02176:
    C248_0911
    11819-97:
    MS7_0869 (sufC)
    71193:
    ST398NM01_0897
    ECT-R 2:
    ECTR2_769 (sufC)
    ED133:
    SAOV_0859
    ED98:
    SAAV_0813
    HO 5096 0412:
    SAEMRSA15_07440
    JH1:
    SaurJH1_0859
    JH9:
    SaurJH9_0843
    JKD6008:
    SAA6008_00864 (sufC)
    JKD6159:
    SAA6159_00773 (sufC)
    LGA251:
    SARLGA251_07710
    M013:
    M013TW_0834
    MRSA252:
    SAR0876
    MSHR1132:
    SAMSHR1132_07660
    MSSA476:
    SAS0784
    Mu3:
    SAHV_0838
    Mu50:
    SAV0842
    MW2:
    MW0795
    RF122:
    SAB0774
    ST398:
    SAPIG0897 (sufC)
    T0131:
    SAT0131_00941 (leuC)
    TCH60:
    HMPREF0772_12334 (sufC)
    TW20:
    SATW20_09140
    USA300_TCH1516:
    USA300HOU_0870
    VC40:
    SAVC_03745

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MASTLEIKDLHVSIEDKEILKGVNLTINTDEIHAIMGPNGTGKSTLSSAIMGHPSYEVTK
    N315            MASTLEIKDLHVSIEDKEILKGVNLTINTDEIHAIMGPNGTGKSTLSSAIMGHPSYEVTK
    NCTC8325        MASTLEIKDLHVSIEDKEILKGVNLTINTDEIHAIMGPNGTGKSTLSSAIMGHPSYEVTK
    Newman          MASTLEIKDLHVSIEDKEILKGVNLTINTDEIHAIMGPNGTGKSTLSSAIMGHPSYEVTK
    USA300_FPR3757  MASTLEIKDLHVSIEDKEILKGVNLTINTDEIHAIMGPNGTGKSTLSSAIMGHPSYEVTK
                    ************************************************************

    COL             GEVLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLMQ
    N315            GEVLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLMQ
    NCTC8325        GEVLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLMQ
    Newman          GEVLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLMQ
    USA300_FPR3757  GEVLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLMQ
                    ************************************************************

    COL             FIKKLDKNMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID
    N315            FIKKLDKNMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID
    NCTC8325        FIKKLDKNMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID
    Newman          FIKKLDKNMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID
    USA300_FPR3757  FIKKLDKNMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID
                    ************************************************************

    COL             ALKVVSKGINQMRGENFGALMITHYQRLLNYITPDKVHVMYAGKVVKSGGPELAKRLEEE
    N315            ALKVVSKGINQMRGENFGALMITHYQRLLNYITPDKVHVMYAGKVVKSGGPELAKRLEEE
    NCTC8325        ALKVVSKGINQMRGENFGALMITHYQRLLNYITPDKVHVMYAGKVVKSGGPELAKRLEEE
    Newman          ALKVVSKGINQMRGENFGALMITHYQRLLNYITPDKVHVMYAGKVVKSGGPELAKRLEEE
    USA300_FPR3757  ALKVVSKGINQMRGENFGALMITHYQRLLNYITPDKVHVMYAGKVVKSGGPELAKRLEEE
                    ************************************************************

    COL             GYEWVKEEFGSAE
    N315            GYEWVKEEFGSAE
    NCTC8325        GYEWVKEEFGSAE
    Newman          GYEWVKEEFGSAE
    USA300_FPR3757  GYEWVKEEFGSAE
                    *************