From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002897000
  • symbol?: sufS
  • description?: aminotransferase

      descriptions from strain specific annotations:

    • aminotransferase
    • SufS subfamily cysteine desulfurase
    • cysteine desulfurase
    • cysteine desulfurase SufS subfamily protein
    • cysteine desulfurase, SufS subfamily
    • aminotransferase NifS homologue
    • aminotransferase NifS-like protein
    • cysteine desulfurase (Selenocysteine lyase) (Selenocysteine reductase) (Selenocysteine beta-lyase) (SCL)
    • cysteine desulfurases, SufS subfamily subfamily
    • putative cysteine desulfurase
    • putative selenocysteine lyase
    • selenocysteine lyase
  • strand?: +
  • coordinates?: 3341724..3342974
  • synteny block?: BlockID0020630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0787 (sufS)
    USA300_FPR3757:
    04-02981:
    SA2981_0799 (nifS)
    08BA02176:
    C248_0913 (csdB)
    11819-97:
    MS7_0871 (csd)
    71193:
    ST398NM01_0899
    ECT-R 2:
    ECTR2_771 (sufS)
    ED133:
    SAOV_0861
    ED98:
    SAAV_0815
    HO 5096 0412:
    SAEMRSA15_07460 (csdB)
    JH1:
    SaurJH1_0861
    JH9:
    SaurJH9_0845
    JKD6008:
    SAA6008_00866 (sufS)
    JKD6159:
    SAA6159_00775 (sufS)
    LGA251:
    SARLGA251_07730 (csdB)
    M013:
    M013TW_0836
    MRSA252:
    SAR0878 (csdB)
    MSHR1132:
    SAMSHR1132_07680
    MSSA476:
    SAS0786
    Mu3:
    SAHV_0840
    Mu50:
    SAV0844
    MW2:
    MW0797
    RF122:
    SAB0776 (csdB)
    ST398:
    SAPIG0899
    T0131:
    SAT0131_00943
    TCH60:
    HMPREF0772_12332 (sufS)
    TW20:
    SATW20_09160 (csdB)
    USA300_TCH1516:
    USA300HOU_0873 (sufS)
    VC40:
    SAVC_03755

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MAEHSFDVNEVIKDFPILDQKVNGKRLAYLDSTATSQTPVQVLNVLEDYYKRYNSNV
    N315            ---MAEHSFDVNEVIKDFPILDQKVNGKRLAYLDSTATSQTPMQVLNVLEDYYKRYNSNV
    NCTC8325        MNEVAEHSFDVNEVIKDFPILDQKVNGKRLAYLDSTATSQTPVQVLNVLEDYYKRYNSNV
    Newman          MNEVAEHSFDVNEVIKDFPILDQKVNGKRLAYLDSTATSQTPVQVLNVLEDYYKRYNSNV
    USA300_FPR3757  ---MAEHSFDVNEVIKDFPILDQKVNGKRLAYLDSTATSQTPVQVLNVLEDYYKRYNSNV
                       :**************************************:*****************

    COL             HRGVHTLGSLATDGYENARETVRRFINAKYFEEIIFTRGTTASINLVAHSYGDANVEEGD
    N315            HRGVHTLGSLATDGYENARETVRRFINAKYFEEIIFTRGTTASINLVAHSYGDANVEEGD
    NCTC8325        HRGVHTLGSLATDGYENARETVRRFINAKYFEEIIFTRGTTASINLVAHSYGDANVEEGD
    Newman          HRGVHTLGSLATDGYENARETVRRFINAKYFEEIIFTRGTTASINLVAHSYGDANVEEGD
    USA300_FPR3757  HRGVHTLGSLATDGYENARETVRRFINAKYFEEIIFTRGTTASINLVAHSYGDANVEEGD
                    ************************************************************

    COL             EIVVTEMEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQTINDKTKIVAIAHIS
    N315            EIVVTEMEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQTINDKTKIVAIAHIS
    NCTC8325        EIVVTEMEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQTINDKTKIVAIAHIS
    Newman          EIVVTEMEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQTINDKTKIVAIAHIS
    USA300_FPR3757  EIVVTEMEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQTINDKTKIVAIAHIS
                    ************************************************************

    COL             NVLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQEMNADFYSFSGHKMLGPTGIG
    N315            NVLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQEMNADFYSFSGHKMLGPTGIG
    NCTC8325        NVLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQEMNADFYSFSGHKMLGPTGIG
    Newman          NVLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQEMNADFYSFSGHKMLGPTGIG
    USA300_FPR3757  NVLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQEMNADFYSFSGHKMLGPTGIG
                    ************************************************************

    COL             VLFGKRELLQKMEPIEFGGDMIDFVSKYDATWADLPTKFEAGTPLIAQAIGLAEAIRYLE
    N315            VLFGKRELLQKMEPIEFGGDMIDFVSKYDATWADLPTKFEAGTPLIAQAIGLAEAIRYLE
    NCTC8325        VLFGKRELLQKMEPIEFGGDMIDFVSKYDATWADLPTKFEAGTPLIAQAIGLAEAIRYLE
    Newman          VLFGKRELLQKMEPIEFGGDMIDFVSKYDATWADLPTKFEAGTPLIAQAIGLAEAIRYLE
    USA300_FPR3757  VLFGKRELLQKMEPIEFGGDMIDFVSKYDATWADLPTKFEAGTPLIAQAIGLAEAIRYLE
                    ************************************************************

    COL             RIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVITFNLQDVHPHDVATAVDT
    N315            RIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVITFNLQDVHPHDVATAVDT
    NCTC8325        RIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVITFNLQDVHPHDVATAVDT
    Newman          RIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVITFNLQDVHPHDVATAVDT
    USA300_FPR3757  RIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVITFNLQDVHPHDVATAVDT
                    ************************************************************

    COL             EGVAVRAGHHCAQPLMKWLNVSSTARASFYIYNTKEDVDQLINALKQTKEFFSYEF
    N315            EGVAVRAGHHCAQPLMKWLNVSSTARASFYIYNTKEDIDQLINALKQTKEFFSYEF
    NCTC8325        EGVAVRAGHHCAQPLMKWLNVSSTARASFYIYNTKEDVDQLINALKQTKEFFSYEF
    Newman          EGVAVRAGHHCAQPLMKWLNVSSTARASFYIYNTKEDVDQLINALKQTKEFFSYEF
    USA300_FPR3757  EGVAVRAGHHCAQPLMKWLNVSSTARASFYIYNTKEDVDQLINALKQTKEFFSYEF
                    *************************************:******************