From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003023000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3415735..3416127
  • synteny block?: BlockID0021310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0880
    08BA02176:
    C248_0925
    11819-97:
    MS7_0881
    71193:
    ST398NM01_0909
    ECT-R 2:
    ECTR2_781
    ED133:
    SAOV_0872
    ED98:
    SAAV_0886
    HO 5096 0412:
    SAEMRSA15_07560
    JH1:
    SaurJH1_0943
    JH9:
    SaurJH9_0924
    JKD6008:
    SAA6008_00877
    JKD6159:
    SAA6159_00785
    LGA251:
    SARLGA251_08440
    M013:
    M013TW_0845
    MRSA252:
    SAR0888
    MSHR1132:
    SAMSHR1132_07780
    MSSA476:
    SAS0796
    Mu3:
    SAHV_0920
    Mu50:
    SAV0925
    MW2:
    MW0808
    RF122:
    SAB0792
    ST398:
    SAPIG0909
    T0131:
    SAT0131_00956 (rsbU)
    TCH60:
    HMPREF0772_12321
    TW20:
    SATW20_09260
    USA300_TCH1516:
    USA300HOU_0886
    VC40:
    SAVC_03805

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNLIKVDQHYFELIENYRECFNEEQFIARYSDILDKYDYIVGDYGYDQLRLKGFYKDSN
    N315            ---MIKVDQHYFELIENYRECFNEEQFIARYSDILDKYDYIVGDYGYDQLRLKGFYKDSN
    NCTC8325        ---MIKVDQHYFELIENYRECFNEEQFIARYSDILDKYDYIVGDYGYDQLRLKGFYKDSN
    Newman          MKNLIKVDQHYFELIENYRECFNEEQFIARYSDILDKYDYIVGDYGYDQLRLKGFYKDSN
    USA300_FPR3757  ---MIKVDQHYFELIENYRECFNEEQFIARYSDILDKYDYIVGDYGYDQLRLKGFYKDSN
                       :********************************************************

    COL             KKAEMSKRFSNIQDYIFEYCNFGCPYFVLRHLSKQEVKKLIEEVHPSDVIDDDNKLQDVK
    N315            KKAEMSKRFSNIQDYIFEYCNFGCPYFVLRHLSKQEVKKLIEEVHPSDVIDDDNKLQDVK
    NCTC8325        KKAEMSKRFSNIQDYIFEYCNFGCPYFVLRHLSKQEVKKLIEEVHPSDVIDDDNKLQDVK
    Newman          KKAEMSKRFSNIQDYIFEYCNFGCPYFVLRHLSKQEVKKLIEEVHPSDVIDDDNKLQDVK
    USA300_FPR3757  KKAEMSKRFSNIQDYIFEYCNFGCPYFVLRHLSKQEVKKLIEEVHPSDVIDDDNKLQDVK
                    ************************************************************

    COL             IKPTIQDTEH
    N315            IKPTIQDTEH
    NCTC8325        IKPTIQDTEH
    Newman          IKPTIQDTEH
    USA300_FPR3757  IKPTIQDTEH
                    **********