From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003036000
  • symbol?:
  • description?: disulfide oxidoreductase

      descriptions from strain specific annotations:

    • disulfide oxidoreductase
    • conserved protein YuzD
    • YuzD-like protein
  • strand?: +
  • coordinates?: 3425896..3426231
  • synteny block?: BlockID0021440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0892 (yuzD)
    08BA02176:
    C248_0936
    11819-97:
    MS7_0892
    71193:
    ST398NM01_0920
    ECT-R 2:
    ECTR2_793
    ED133:
    SAOV_0883
    ED98:
    SAAV_0898
    HO 5096 0412:
    SAEMRSA15_07670
    JH1:
    SaurJH1_0956
    JH9:
    SaurJH9_0937
    JKD6008:
    SAA6008_00888
    JKD6159:
    SAA6159_00796
    LGA251:
    SARLGA251_08550
    M013:
    M013TW_0856
    MRSA252:
    SAR0899
    MSHR1132:
    SAMSHR1132_07890
    MSSA476:
    SAS0807
    Mu3:
    SAHV_0932
    Mu50:
    SAV0937
    MW2:
    MW0819
    RF122:
    SAB0803
    ST398:
    SAPIG0920
    T0131:
    SAT0131_00967 (kdpB)
    TCH60:
    HMPREF0772_12310
    TW20:
    SATW20_09370
    USA300_TCH1516:
    USA300HOU_0898
    VC40:
    SAVC_03860

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----MEHVSVVVYGADVICASCVNAPTSKDIYDWLQPLLKRKYPNISFKYTYIDITKDN
    N315            ----------MVVYGADVICASCVNAPTSKDIYDWLQPLLKRKYPNISFKYTYIDITKDN
    NCTC8325        -----MEHVSVVVYGADVICASCVNAPTSKDIYDWLQPLLKRKYPNISFKYTYIDITKDN
    Newman          MGDKYMEHVSVVVYGADVICASCVNAPTSKDIYDWLQPLLKRKYPNISFKYTYIDITKDN
    USA300_FPR3757  -----MEHVSVVVYGADVICASCVNAPTSKDIYDWLQPLLKRKYPNISFKYTYIDITKDN
                              :*************************************************

    COL             DNLTDHDLQFIERIEQDELFYPLITMNDEYVADGYIQTKQITRFIDQKLVNE
    N315            DNLTDHDLQFIERIEQDELFYPLITMNDEYVADGYIQTKQITRFIDQKLVNE
    NCTC8325        DNLTDHDLQFIERIEQDELFYPLITMNDEYVADGYIQTKQITRFIDQKLVNE
    Newman          DNLTDHDLQFIERIEQDELFYPLITMNDEYVADGYIQTKQITRFIDQKLVNE
    USA300_FPR3757  DNLTDHDLQFIERIEQDELFYPLITMNDEYVADGYIQTKQITRFIDQKLVNE
                    ****************************************************