From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003049000
  • symbol?: mnhE
  • description?: monovalent cation/H+ antiporter subunit E

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit E
    • putative monovalent cation/H+ antiporter subunit E
    • Na(+) H(+) antiporter subunit E
    • multicomponent Na+:H+ antiporter family protein
    • Na(+)/H(+) antiporter subunit E
    • Na+/H+ antiporter subunit
    • monovalent cation antiporter-3 subunit E, MnhE
    • CPA3 family monovalent cation:proton (H+) antiporter-3 subunit E
    • Na(+)/H(+) antiporter subunit E1
    • Na(+)/H(+) antiporter subunit E (Multiple resistance and pHhomeostasis protein E) (Mrp complex subunit E)
    • ShaE
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3 MnhE subunit
  • strand?: -
  • coordinates?: 3438933..3439412
  • synteny block?: BlockID0021570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0951 (mnhE)
    N315:
    SA0809 (mnhE)
    NCTC8325:
    Newman:
    NWMN_0818 (mnhE)
    USA300_FPR3757:
    04-02981:
    SA2981_0903 (mnhE)
    08BA02176:
    C248_0947 (mnhE)
    11819-97:
    MS7_0903 (mrpE)
    71193:
    ST398NM01_0931
    ECT-R 2:
    ECTR2_804 (mnhC)
    ED133:
    SAOV_0894c
    ED98:
    SAAV_0909 (mnhE)
    HO 5096 0412:
    SAEMRSA15_07780 (mnhE)
    JH1:
    SaurJH1_0967
    JH9:
    SaurJH9_0948
    JKD6008:
    SAA6008_00901 (mnhE)
    JKD6159:
    SAA6159_00807 (mnhE)
    LGA251:
    SARLGA251_08660 (mnhE)
    M013:
    M013TW_0867
    MRSA252:
    SAR0910 (mnhE)
    MSHR1132:
    SAMSHR1132_08000
    MSSA476:
    SAS0818
    Mu3:
    SAHV_0943 (mnhE)
    Mu50:
    SAV0948 (mnhE)
    MW2:
    MW0830 (mnhE)
    RF122:
    SAB0815c (mnhE)
    ST398:
    SAPIG0931
    T0131:
    SAT0131_00980
    TCH60:
    HMPREF0772_12299 (mnhE)
    TW20:
    SATW20_09480 (mnhE)
    USA300_TCH1516:
    USA300HOU_0908 (mnhE2)
    VC40:
    SAVC_03915

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL
    N315            MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL
    NCTC8325        MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL
    Newman          MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL
    USA300_FPR3757  MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL
                    ************************************************************

    COL             VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG
    N315            VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG
    NCTC8325        VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG
    Newman          VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG
    USA300_FPR3757  VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG
                    ************************************************************

    COL             VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI
    N315            VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI
    NCTC8325        VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI
    Newman          VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI
    USA300_FPR3757  VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI
                    ***************************************