From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003055000
  • symbol?:
  • description?: peptidyl-prolyl cis-trans isomerase

      descriptions from strain specific annotations:

    • peptidyl-prolyl cis-trans isomerase
    • cyclophilin type peptidyl-prolyl cis-trans isomerase
    • putative cyclophilin type peptidyl-prolylcis-trans isomerase
    • putative peptidyl-prolyl cis-trans isomerase
    • peptidyl-prolyl cis-trans isomerase, cyclophilin-type
    • peptidyl-prolyl cis-trans isomerase homologue
    • peptidyl-prolyl cis-trans isomerase-like protein
    • peptidyl-prolyl isomerase
    • peptidylprolyl isomerase domain and WD repeat-containing protein 1
  • strand?: +
  • coordinates?: 3444648..3445241
  • synteny block?: BlockID0021630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0824 (ppi)
    USA300_FPR3757:
    04-02981:
    SA2981_0909
    08BA02176:
    C248_0953
    11819-97:
    MS7_0909
    71193:
    ST398NM01_0937
    ECT-R 2:
    ECTR2_810
    ED133:
    SAOV_0900
    ED98:
    SAAV_0915
    HO 5096 0412:
    SAEMRSA15_07840
    JH1:
    SaurJH1_0973
    JH9:
    SaurJH9_0954
    JKD6008:
    SAA6008_00907 (ppi)
    JKD6159:
    SAA6159_00813 (ppi)
    LGA251:
    SARLGA251_08720
    M013:
    M013TW_0873
    MRSA252:
    SAR0916
    MSHR1132:
    SAMSHR1132_08060
    MSSA476:
    SAS0824
    Mu3:
    SAHV_0949
    Mu50:
    SAV0954
    MW2:
    MW0836
    RF122:
    SAB0821
    ST398:
    SAPIG0937
    T0131:
    SAT0131_00986
    TCH60:
    HMPREF0772_12293 (ppi)
    TW20:
    SATW20_09540
    USA300_TCH1516:
    USA300HOU_0914 (prsA1)
    VC40:
    SAVC_03945

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MANYPQLNKEVQQGEIKVVMHTNKGDMTFKLFPNIAPKTVENFVTHAKNGYYDGITFHRV
    N315            MANYPQLNKEVQQGEIKVVMHTNKGDMTFKLFPNIAPKTVENFVTHAKNGYYDGITFHRV
    NCTC8325        MANYPQLNKEVQQGEIKVVMHTNKGDMTFKLFPNIAPKTVENFVTHAKNGYYDGITFHRV
    Newman          MANYPQLNKEVQQGEIKVVMHTNKGDMTFKLFPNIAPKTVENFVTHAKNGYYDGITFHRV
    USA300_FPR3757  MANYPQLNKEVQQGEIKVVMHTNKGDMTFKLFPNIAPKTVENFVTHAKNGYYDGITFHRV
                    ************************************************************

    COL             INDFMIQGGDPTATGMGGESIYGGAFEDEFSLNAFNLYGALSMANSGPNTNGSQFFIVQM
    N315            INDFMIQGGDPTATGMGGESIYGGAFEDEFSLNAFNLYGALSMANSGPNTNGSQFFIVQM
    NCTC8325        INDFMIQGGDPTATGMGGESIYGGAFEDEFSLNAFNLYGALSMANSGPNTNGSQFFIVQM
    Newman          INDFMIQGGDPTATGMGGESIYGGAFEDEFSLNAFNLYGALSMANSGPNTNGSQFFIVQM
    USA300_FPR3757  INDFMIQGGDPTATGMGGESIYGGAFEDEFSLNAFNLYGALSMANSGPNTNGSQFFIVQM
                    ************************************************************

    COL             KEVPQNMLSQLTDGGWPQPIVDAYGEKGGTPWLDQKHTVFGQIIDGETTLEDIANTKVGP
    N315            KEVPQNMLSQLADGGWPQPIVDAYGEKGGTPWLDQKHTVFGQIIDGETTLEDIANTKVGP
    NCTC8325        KEVPQNMLSQLADGGWPQPIVDAYGEKGGTPWLDQKHTVFGQIIDGETTLEDIANTKVGP
    Newman          KEVPQNMLSQLADGGWPQPIVDAYGEKGGTPWLDQKHTVFGQIIDGETTLEDIANTKVGP
    USA300_FPR3757  KEVPQNMLSQLADGGWPQPIVDAYGEKGGTPWLDQKHTVFGQIIDGETTLEDIANTKVGP
                    ***********:************************************************

    COL             QDKPLHDVVIESIDVEE
    N315            QDKPLHDVVIESIDVEE
    NCTC8325        QDKPLHDVVIESIDVEE
    Newman          QDKPLHDVVIESIDVEE
    USA300_FPR3757  QDKPLHDVVIESIDVEE
                    *****************