From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003114000
  • symbol?:
  • description?: LysR family transcriptional regulator

      descriptions from strain specific annotations:

    • LysR family transcriptional regulator
    • LysR family regulatory protein
    • bacterial regulatory helix-turn-helix , lysR family protein
    • Citrate synthase I repressor
    • regulatory helix-turn-helix protein, lysR family protein
    • regulatory protein LysR family
  • strand?: -
  • coordinates?: 3500929..3501801
  • synteny block?: BlockID0022070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0931 (lysR)
    08BA02176:
    C248_1002
    11819-97:
    MS7_0931
    71193:
    ST398NM01_0975
    ECT-R 2:
    ECTR2_831
    ED133:
    SAOV_0922c
    ED98:
    SAAV_0936
    HO 5096 0412:
    SAEMRSA15_08050
    JH1:
    SaurJH1_0994
    JH9:
    SaurJH9_0975
    JKD6008:
    SAA6008_00928
    JKD6159:
    SAA6159_00835
    LGA251:
    SARLGA251_08930
    M013:
    M013TW_0894
    MRSA252:
    SAR0939
    MSHR1132:
    SAMSHR1132_08270
    MSSA476:
    SAS0846
    Mu3:
    SAHV_0971
    Mu50:
    SAV0976
    MW2:
    MW0858
    RF122:
    SAB0844c
    ST398:
    SAPIG0975
    T0131:
    SAT0131_01009
    TCH60:
    HMPREF0772_12270
    TW20:
    SATW20_09750
    USA300_TCH1516:
    USA300HOU_0934
    VC40:
    SAVC_04050

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLDWYYTFVILAKTLNYRLASEEINLTIPSIHKQIKNLEQHLNVKLFETYKNQIILTED
    N315            MNLDWYYTFVILAKTLNYRLASEEINLTIPSIHKQIKNLEQHLNVKLFETYKNQIILTED
    NCTC8325        MNLDWYYTFVILAKTLNYRLASEEINLTIPSIHKQIKNLEQHLNVKLFETYKNQIILTED
    Newman          MNLDWYYTFVILAKTLNYRLASEEINLTIPSIHKQIKNLEQHLNVKLFETYKNQIILTED
    USA300_FPR3757  MNLDWYYTFVILAKTLNYRLASEEINLTIPSIHKQIKNLEQHLNVKLFETYKNQIILTED
                    ************************************************************

    COL             GHTFLPIAQSFIEQYESGIKHIQLKKTMFQSKLNVVVSSYIATFIMPKFLKSFFNEHPFI
    N315            GHTFLPIAQSFIEQYESGIKHIQLKKTMFQSKLNVVVSSYIATFIMPKFLKSFFNEHPFI
    NCTC8325        GHTFLPIAQSFIEQYESGIKHIQLKKTMFQSKLNVVVSSYIATFIMPKFLKSFFNEHPFI
    Newman          GHTFLPIAQSFIEQYESGIKHIQLKKTMFQSKLNVVVSSYIATFIMPKFLKSFFNEHPFI
    USA300_FPR3757  GHTFLPIAQSFIEQYESGIKHIQLKKTMFQSKLNVVVSSYIATFIMPKFLKSFFNEHPFI
                    ************************************************************

    COL             DVSLHVKNENIEKDINNHTYDIGISRNQPKLREVHSEKVCEGKIVLIAPNKENNHLLTEA
    N315            DVSLHVKNENIEKDINNHTYDIGISRNQPKLREVHSEKVCEGKIVLIAPNKENNHLLTEA
    NCTC8325        DVSLHVKNENIEKDINNHTYDIGISRNQPKLREVHSEKVCEGKIVLIAPNKENNHLLTEA
    Newman          DVSLHVKNENIEKDINNHTYDIGISRNQPKLREVHSEKVCEGKIVLIAPNKENNHLLTEA
    USA300_FPR3757  DVSLHVKNENIEKDINNHTYDIGISRNQPKLREVHSEKVCEGKIVLIAPNKENNHLLTEA
                    ************************************************************

    COL             SLFEKYKIISDNHPEYWSSLKNNILNIYEKAQFLSINDVHTSIKLIEMNQGISFLPLYIT
    N315            SLFEKYKIISDNHPEYWSSLKNNILNIYGKAQFLSINDVHTSIKLIEMNQGISFLPIYIT
    NCTC8325        SLFEKYKIISDNHPEYWSSLKNNILNIYEKAQFLSINDVHTSIKLIEMNQGISFLPLYIT
    Newman          SLFEKYKIISDNHPEYWSSLKNNILNIYEKAQFLSINDVHTSIKLIEMNQGISFLPLYIT
    USA300_FPR3757  SLFEKYKIISDNHPEYWSSLKNNILNIYEKAQFLSINDVHTSIKLIEMNQGISFLPLYIT
                    **************************** ***************************:***

    COL             TNSDYNISVINTKILQAPISFTYIYSKKESPEILVFIKSFKKYIANEQL
    N315            TDSDYNISVINTKILQAPISFTYIYSKKESPEILVFIKSFKKYIANEQL
    NCTC8325        TNSDYNISVINTKILQAPISFTYIYSKKESPEILVFIKSFKKYIANEQL
    Newman          TNSDYNISVINTKILQAPISFTYIYSKKESPEILVFIKSFKKYIANEQL
    USA300_FPR3757  TNSDYNISVINTKILQAPISFTYIYSKKESPEILVFIKSFKKYIANEQL
                    *:***********************************************