From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003121000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • major facilitator superfamily protein
  • strand?: +
  • coordinates?: 3503701..3508117
  • synteny block?: BlockID0022130
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0934
    08BA02176:
    11819-97:
    MS7_0934
    71193:
    ECT-R 2:
    ECTR2_834
    ED133:
    SAOV_0925
    ED98:
    SAAV_0940
    HO 5096 0412:
    SAEMRSA15_08080
    JH1:
    SaurJH1_0997
    JH9:
    SaurJH9_0978
    JKD6008:
    SAA6008_00932
    JKD6159:
    LGA251:
    SARLGA251_08960
    M013:
    M013TW_0901
    MRSA252:
    SAR0942
    MSHR1132:
    MSSA476:
    SAS0849
    Mu3:
    SAHV_0974
    Mu50:
    SAV0979
    MW2:
    MW0861
    RF122:
    ST398:
    T0131:
    SAT0131_01012 (atpA)
    TCH60:
    HMPREF0772_12266
    TW20:
    SATW20_09780
    USA300_TCH1516:
    USA300HOU_0938
    VC40:
    SAVC_04065

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKLILGIYLYRIFSRAYFYLPFLLIYFLIQGYSIIQLEILMASYGIAAFLFSLYKEKCF
    N315            MNKLILGIYLYRIFSRAYFYLPFLLIYFLIQGYSIIQLEILMASYGIAAFLFSLYKEKCF
    NCTC8325        MNKLILGIYLYRIFSRAYFYLPFLLIYFLIQGYSIIQLEILMASYGIAAFLFSLYKEKCF
    Newman          MNKLILGIYLYRIFSRAYFYLPFLLIYFLIQGYSIIQLEILMASYGIAAFLFSLYKEKCF
    USA300_FPR3757  MNKLILGIYLYRIFSRAYFYLPFLLIYFLIQGYSIIQLEILMASYGIAAFLFSLYKEKCF
                    ************************************************************

    COL             KICNLKDSNKLVVSEIFKIIGLLLLLYQNQYLILVVAQILLGLSYSMMAGVDTAIIKRNI
    N315            KICNLKDSNKLVVSEIFKIIGLLLLLYQNQYLILVVAQILLGLSYSMMAGVDTAIIKRNI
    NCTC8325        KICNLKDSNKLVVSEIFKIIGLLLLLYQNQYLILVVAQILLGLSYSMMAGVDTAIIKRNI
    Newman          KICNLKDSNKLVVSEIFKIIGLLLLLYQNQYLILVVAQILLGLSYSMMAGVDTAIIKRNI
    USA300_FPR3757  KICNLKDSNKLVVSEIFKIIGLLLLLYQNQYLILVVAQILLGLSYSMMAGVDTAIIKRNI
                    ************************************************************

    COL             TNEKYVQNKSNSYMFLSLLISGIIGSYLYGINIKWPIIMTGIFSILTIIIIRCTLVENRE
    N315            TNEKYVQNKSNSYMFLSLLISGIIGSYLYGINIKWPIIMTGIFSILTIIIIRCTLVENRE
    NCTC8325        TNEKYVQNKSNSYMFLSLLISGIIGSYLYGINIKWPIIMTGIFSILTIIIIRCTLVENRE
    Newman          TNEKYVQNKSNSYMFLSLLISGIIGSYLYGINIKWPIIMTGIFSILTIIIIRCTLVENRE
    USA300_FPR3757  TNEKYVQNKSNSYMFLSLLISGIIGSYLYGINIKWPIIMTGIFSILTIIIIRCTLVENRE
                    ************************************************************

    COL             LNLIGETKGKIKKFLPEEKFWILHYSFLRALILGFFIGFIPINIYNDLKLNNLQFISVLT
    N315            LNLIGETKGKIKKFLPEEKFWILHYSFLRALILGFFIGFIPINIYNDLKLNNLQFISVLT
    NCTC8325        LNLIGETKGKIKKFLPEEKFWILHYSFLRALILGFFIGFIPINIYNDLKLNNLQFISVLT
    Newman          LNLIGETKGKIKKFLPEEKFWILHYSFLRALILGFFIGFIPINIYNDLKLNNLQFISVLT
    USA300_FPR3757  LNLIGETKGKIKKFLPEEKFWILHYSFLRALILGFFIGFIPINIYNDLKLNNLQFISVLT
                    ************************************************************

    COL             CYTVMGFVSSRYLTKYLNYKFVSEICLVIFLIIYTYQSFIAVTISMIFLGISSGLTRPQT
    N315            CYTVMGYLSSRYLTKYLNYKFVSEICLIIFLIIYTYQSFIAVTISMIFLGISSGLTRPQT
    NCTC8325        CYTVMGFVSSRYLTKYLNYKFVSEICLVIFLIIYTYQSFIAVTISMIFLGISSGLTRPQT
    Newman          CYTVMGFVSSRYLTKYLNYKFVSEICLVIFLIIYTYQSFIAVTISMIFLGISSGLTRPQT
    USA300_FPR3757  CYTVMGFVSSRYLTKYLNYKFVSEICLVIFLIIYTYQSFIAVTISMIFLGISSGLTRPQT
                    ******::*******************:********************************

    COL             INKLSSSSNLRVMLNYAETLYFIFNIAFLLMGGYLYTIGTIQYLILFISLLIFIYLIIIF
    N315            INKLSSSSNLRVMLNYAETLYFIFNIAFLLIGGYLYSIGTIQYLMLFMSLLTFIYLLTLF
    NCTC8325        INKLSSSSNLRVMLNYAETLYFIFNIAFLLMGGYLYTIGTIQYLILFISLLIFIYLIIIF
    Newman          INKLSSSSNLRVMLNYAETLYFIFNIAFLLMGGYLYTIGTIQYLILFISLLIFIYLIIIF
    USA300_FPR3757  INKLSSSSNLRVMLNYAETLYFIFNIAFLLMGGYLYTIGTIQYLILFISLLIFIYLIIIF
                    ******************************:*****:*******:**:*** ****: :*

    COL             YFTRREQHENKN--
    N315            YL-RRDQHENQHRI
    NCTC8325        YFTRREQHENKN--
    Newman          YFTRREQHENKN--
    USA300_FPR3757  YFTRREQHENKN--
                    *: **:****::