From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003123000
  • symbol?:
  • description?: PEBP family protein

      descriptions from strain specific annotations:

    • PEBP family protein
    • Phospholipid-binding protein
    • phosphatidylethanolamine-binding family protein
    • phosphatidylethanolamine-binding protein
    • putative phospholipid-binding protein
  • strand?: +
  • coordinates?: 3508101..3508616
  • synteny block?: BlockID0022150
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0935
    08BA02176:
    C248_1003
    11819-97:
    MS7_0935
    71193:
    ST398NM01_0976
    ECT-R 2:
    ECTR2_835
    ED133:
    SAOV_0926
    ED98:
    SAAV_0941
    HO 5096 0412:
    SAEMRSA15_08090
    JH1:
    SaurJH1_0998
    JH9:
    SaurJH9_0979
    JKD6008:
    SAA6008_00933
    JKD6159:
    SAA6159_00836
    LGA251:
    SARLGA251_08970
    M013:
    M013TW_0902
    MRSA252:
    SAR0943
    MSHR1132:
    SAMSHR1132_08280
    MSSA476:
    SAS0850
    Mu3:
    SAHV_0975
    Mu50:
    SAV0980
    MW2:
    MW0862
    RF122:
    SAB0845
    ST398:
    SAPIG0976
    T0131:
    SAT0131_01013 (atpH)
    TCH60:
    HMPREF0772_12265
    TW20:
    SATW20_09790
    USA300_TCH1516:
    VC40:
    SAVC_04070

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIKTEFKGNNIPYEYAAGADVSDSINGNPIKSFPFEVIELPEGTKYLAWSLIDYDAIPV
    N315            MKINTEFKGNNIPYEYAAGADISDLINGNPIKSFPFEITELPKDTKYLAWSLIDYDAIPV
    NCTC8325        MKIKTEFKGNNIPYEYAAGADVSDSINGNPIKSFPFEVIELPEGTKYLAWSLIDYDAIPV
    Newman          MKIKTEFKGNNIPYEYAAGADVSDSINGNPIKSFPFEVIELPEGTKYLAWSLIDYDAIPV
    USA300_FPR3757  MKIKTEFKGNNIPYEYAAGADVSDSINGNPIKSFPFEVIELPEGTKYLAWSLIDYDAIPV
                    ***:*****************:** ************: ***:.****************

    COL             CGFAWIHWSVANVSVSGNSISIKADLSRTKGDYVQGKNSFTSGLLAEDFSEIENHYVGPT
    N315            CGFAWIHWSVANVSITGDSISIKADLSRTKGDYVQGKNSFTSGLLAEDFSEIENHYVGPT
    NCTC8325        CGFAWIHWSVANVSVSGNSISIKADLSRTKGDYVQGKNSFTSGLLAEDFSEIENHYVGPT
    Newman          CGFAWIHWSVANVSVSGNSISIKADLSRTKGDYVQGKNSFTSGLLAEDFSEIENHYVGPT
    USA300_FPR3757  CGFAWIHWSVANVSVSGNSISIKADLSRTKGDYVQGKNSFTSGLLAEDFSEIENHYVGPT
                    **************::*:******************************************

    COL             PPDQDHQYELTVYALDHSLNLKNGFYLNEFLKEVNQHKIDQTSINLIGRKI
    N315            PPDKDHQYELTVYALDHSLNLKNGFYLNEFLKEVNQHKIDQTSINLIGRKI
    NCTC8325        PPDQDHQYELTVYALDHSLNLKNGFYLNEFLKEVNQHKIDQTSINLIGRKI
    Newman          PPDQDHQYELTVYALDHSLNLKNGFYLNEFLKEVNQHKIDQTSINLIGRKI
    USA300_FPR3757  PPDQDHQYELTVYALDHSLNLKNGFYLNEFLKEVNQHKIDQTSINLIGRKI
                    ***:***********************************************