From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003133000
  • symbol?: opp-3B
  • description?: oligopeptide transport system permease

      descriptions from strain specific annotations:

    • oligopeptide transport system permease
    • binding-protein-dependent transport system inner membrane protein
    • oligopeptide transport system permease protein
    • peptide ABC transporter permease
    • Oligopeptide transport system permease protein oppB
    • oligopeptide transport system permease OppB
    • binding--dependent transport system inner membrane component family protein
    • oligopeptide ABC transporter permease
    • oligopeptide ABC transporter membrane protein
    • putative oligopeptide transport system permeaseprotein
    • oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein
    • nickel ABC transporter
    • oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein, Opp3B
  • strand?: +
  • coordinates?: 3516549..3517475
  • synteny block?: BlockID0022250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0991 (oppB)
    N315:
    SA0845 (oppB)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0941 (oppB)
    08BA02176:
    C248_1009 (oppB1)
    11819-97:
    MS7_0941
    71193:
    ST398NM01_0982
    ECT-R 2:
    ECTR2_841
    ED133:
    SAOV_0932
    ED98:
    SAAV_0947 (oppB)
    HO 5096 0412:
    SAEMRSA15_08150 (oppB)
    JH1:
    SaurJH1_1004
    JH9:
    SaurJH9_0985
    JKD6008:
    SAA6008_00939 (oppB)
    JKD6159:
    SAA6159_00843 (opp3B)
    LGA251:
    SARLGA251_09020 (oppB)
    M013:
    M013TW_0908
    MRSA252:
    SAR0949 (oppB)
    MSHR1132:
    SAMSHR1132_08340
    MSSA476:
    SAS0856
    Mu3:
    SAHV_0981 (oppB)
    Mu50:
    SAV0986 (oppB)
    MW2:
    MW0868 (oppB)
    RF122:
    SAB0852 (oppB)
    ST398:
    SAPIG0982
    T0131:
    SAT0131_01019
    TCH60:
    HMPREF0772_12259 (oppB)
    TW20:
    SATW20_09840 (oppB)
    USA300_TCH1516:
    USA300HOU_0944 (oppB1)
    VC40:
    SAVC_04100

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------------------MKLMPGSPFNDAKLNAEQKEILNEKYGLNDPVAT
    N315            MGKYIFKRFIYMLISLFIIITITFFLMKLMPGSPFNDAKLNAEQKEILNEKYGLNDPVAT
    NCTC8325        MGKYIFKRFIYMLISLFIIITITFFLMKLMPGSPFNDAKLNAEQKEILNEKYGLNDPVAT
    Newman          MGKYIFKRFIYMLISLFIIITITFFLMKLMPGSPFNDAKLNAEQKEILNEKYGLNDPVAT
    USA300_FPR3757  MGKYIFKRFIYMLISLFIIITITFFLMKLMPGSPFNDAKLNAEQKEILNEKYGLNDPVAT
                                              **********************************

    COL             QYLHYLKNVVTGDFGNSFQYHNQPVWDLIKPRLLPSFEMGLTAMFIGVILGLILGVAAAT
    N315            QYLHYLKNVVTGDFGNSFQYHNQPVWDLIKPRLLPSFEMGLTAMFIGVILGLILGVAAAT
    NCTC8325        QYLHYLKNVVTGDFGNSFQYHNQPVWDLIKPRLLPSFEMGLTAMFIGVILGLILGVAAAT
    Newman          QYLHYLKNVVTGDFGNSFQYHNQPVWDLIKPRLLPSFEMGLTAMFIGVILGLILGVAAAT
    USA300_FPR3757  QYLHYLKNVVTGDFGNSFQYHNQPVWDLIKPRLLPSFEMGLTAMFIGVILGLILGVAAAT
                    ************************************************************

    COL             KQNSWVDYTTTVISVIAVSVPSFVLAVLLQYVFAVKLRWFPVAGWEGFSTAVLPSLALSA
    N315            KQNSWVDYTTTVISVIAVSVPSFVLAVLLQYVFAVKLRWFPVAGWEGFSTAVLPSLALSA
    NCTC8325        KQNSWVDYTTTVISVIAVSVPSFVLAVLLQYVFAVKLRWFPVAGWEGFSTAVLPSLALSA
    Newman          KQNSWVDYTTTVISVIAVSVPSFVLAVLLQYVFAVKLRWFPVAGWEGFSTAVLPSLALSA
    USA300_FPR3757  KQNSWVDYTTTVISVIAVSVPSFVLAVLLQYVFAVKLRWFPVAGWEGFSTAVLPSLALSA
                    ************************************************************

    COL             AVLATVARYIRAEMIEVLSSDYILLARAKGNSTMRVLFGHALRNALIPIITIIVPMLASI
    N315            AVLATVARYIRAEMIEVLSSDYILLARAKGNSTMRVLFGHALRNALIPIITIIVPMLASI
    NCTC8325        AVLATVARYIRAEMIEVLSSDYILLARAKGNSTMRVLFGHALRNALIPIITIIVPMLASI
    Newman          AVLATVARYIRAEMIEVLSSDYILLARAKGNSTMRVLFGHALRNALIPIITIIVPMLASI
    USA300_FPR3757  AVLATVARYIRAEMIEVLSSDYILLARAKGNSTMRVLFGHALRNALIPIITIIVPMLASI
                    ************************************************************

    COL             LTGTLTIENIFGVPGLGDQFVRSITTNDFSVIMAITLLFSTLFIVSIFIVDILYGVIDPR
    N315            LTGTLTIENIFGVPGLGDQFVRSITTNDFSVIMAITLLFSTLFIVSIFIVDILYGVIDPR
    NCTC8325        LTGTLTIENIFGVPGLGDQFVRSITTNDFSVIMAITLLFSTLFIVSIFIVDILYGVIDPR
    Newman          LTGTLTIENIFGVPGLGDQFVRSITTNDFSVIMAITLLFSTLFIVSIFIVDILYGVIDPR
    USA300_FPR3757  LTGTLTIENIFGVPGLGDQFVRSITTNDFSVIMAITLLFSTLFIVSIFIVDILYGVIDPR
                    ************************************************************

    COL             IRVQGGKK
    N315            IRVQGGKK
    NCTC8325        IRVQGGKK
    Newman          IRVQGGKK
    USA300_FPR3757  IRVQGGKK
                    ********