From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003137000
  • symbol?: opp-3A
  • description?: peptide ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • peptide ABC transporter substrate-binding protein
    • oligopeptide ABC transporter substrate-binding protein
    • oligopeptide ABC transporter oligopeptide-binding protein
    • oligopeptide ABC superfamily ATP binding cassette transporter, binding protein
    • Oligopeptide-binding protein
    • transport system extracellular bindinglipoprotein
    • 4-phytase
    • extracellular solute-binding proteins, family 5 Middle family protein
    • oligopeptide ABC superfamily ATP binding cassette transporter, binding protein, Opp3A
    • oligopeptide ABC transporter, oligopeptide-binding protein
    • Oligopeptide ABC transporter, periplasmic oligopeptide-binding protein oppA
    • oligopeptide ABC transporter substrate-binding protein OppA
    • peptide binding protein OppA
    • pseudogene
  • strand?: +
  • coordinates?: 3520594..3522249
  • synteny block?: BlockID0022290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0945 (oppA)
    08BA02176:
    C248_1013
    11819-97:
    MS7_0945
    71193:
    ST398NM01_0986
    ECT-R 2:
    ECTR2_845
    ED133:
    SAOV_0936
    ED98:
    SAAV_0951
    HO 5096 0412:
    SAEMRSA15_08190
    JH1:
    SaurJH1_1008
    JH9:
    SaurJH9_0989
    JKD6008:
    SAA6008_00943 (oppA)
    JKD6159:
    SAA6159_00847 (opp3A)
    LGA251:
    SARLGA251_09060
    M013:
    M013TW_0912
    MRSA252:
    SAR0953
    MSHR1132:
    SAMSHR1132_08380
    MSSA476:
    SAS0860
    Mu3:
    SAHV_0985
    Mu50:
    SAV0990
    MW2:
    MW0872
    RF122:
    SAB0856
    ST398:
    SAPIG0986
    T0131:
    SAT0131_01023
    TCH60:
    HMPREF0772_12255 (oppA)
    TW20:
    SATW20_09880
    USA300_TCH1516:
    USA300HOU_0948 (oppA1)
    VC40:
    SAVC_04120

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTRKFRTLILILIATIALSGCANDDGIYSDKGQVFRKILSSDLTSLDTSLITDEISSEVT
    N315            MTRKFRTLILILIATIALSGCANDDGIYSDKGQVFRKILSSDLTSLDTSLITDEISSEVT
    NCTC8325        MTRKFRTLILILIATIALSGCANDDGIYSDKGQVFRKILSSDLTSLDTSLITDEISSEVT
    Newman          MTRKFRTLILILIATIALSGCANDDGIYSDKGQVFRKILSSDLTSLDTSLITDEISSEVT
    USA300_FPR3757  MTRKFRTLILILIATIALSGCANDDGIYSDKGQVFRKILSSDLTSLDTSLITDEISSEVT
                    ************************************************************

    COL             AQTFEGLYTLGKGDKPVLGVAKAFPEKSKDGKTLKVKLRSDAKWSNGDKVTAQDFVYAWR
    N315            AQTFEGLYTLGKGDKPVLGVAKAFPEKSKDGKTLKVKLRSDAKWSNGDKVTAQDFVYAWR
    NCTC8325        AQTFEGLYTLGKGDKPVLGVAKAFPEKSKDGKTLKVKLRSDAKWSNGDKVTAQDFVYAWR
    Newman          AQTFEGLYTLGKGDKPVLGVAKAFPEKSKDGKTLKVKLRSDAKWSNGDKVTAQDFVYAWR
    USA300_FPR3757  AQTFEGLYTLGKGDKPVLGVAKAFPEKSKDGKTLKVKLRSDAKWSNGDKVTAQDFVYAWR
                    ************************************************************

    COL             KTVDPKTGSEFAYIMGDIKNASDISTGKKPVEQLGIKALNDETLQIELEKPVPYINQLLA
    N315            KTVDPKTGSEFAYIMGDIKNASDISTGKKPVEQLGIKALNDETLQIELEKPVPYINQLLA
    NCTC8325        KTVDPKTGSEFAYIMGDIKNASDISTGKKPVEQLGIKALNDETLQIELEKPVPYINQLLA
    Newman          KTVDPKTGSEFAYIMGDIKNASDISTGKKPVEQLGIKALNDETLQIELEKPVPYINQLLA
    USA300_FPR3757  KTVDPKTGSEFAYIMGDIKNASDISTGKKPVEQLGIKALNDETLQIELEKPVPYINQLLA
                    ************************************************************

    COL             LNTFAPQNEKVAKKYGKNYGTAADRAVYNGPFKVDDWKQEDKTLLSKNQYYWDKKNVKLD
    N315            LNTFAPQNEKVAKKYGKNYGTAADRAVYNGPFKVDDWKQEDKTLLSKNQYYWDKKNVKLD
    NCTC8325        LNTFAPQNEKVAKKYGKNYGTAADRAVYNGPFKVDDWKQEDKTLLSKNQYYWDKKNVKLD
    Newman          LNTFAPQNEKVAKKYGKNYGTAADRAVYNGPFKVDDWKQEDKTLLSKNQYYWDKKNVKLD
    USA300_FPR3757  LNTFAPQNEKVAKKYGKNYGTAADRAVYNGPFKVDDWKQEDKTLLSKNQYYWDKKNVKLD
                    ************************************************************

    COL             KVNYKVIKDLQAGASLYDTESVDDAVITADQVNKYKDNKGLNFVLTTGTFFVKMNEKQYP
    N315            KVNYKVIKDLQAGASLYDTESVDDAVITADQVNKYKDNKGLNFVLTSGTFFVKMNEKQYP
    NCTC8325        KVNYKVIKDLQAGASLYDTESVDDAVITADQVNKYKDNKGLNFVLTTGTFFVKMNEKQYP
    Newman          KVNYKVIKDLQAGASLYDTESVDDAVITADQVNKYKDNKGLNFVLTTGTFFVKMNEKQYP
    USA300_FPR3757  KVNYKVIKDLQAGASLYDTESVDDAVITADQVNKYKDNKGLNFVLTTGTFFVKMNEKQYP
                    **********************************************:*************

    COL             DFKNKNLRLAIAQAIDKKGYVDSVKNNGSIPSDTLTAKGIAKAPNGKDYASTMNSPLKYN
    N315            DFKNKNLRLAIAQAIDKKGYVDSVKNNGSIPSDTLTAKGIAKAPNGKDYASTMNSPLKYN
    NCTC8325        DFKNKNLRLAIAQAIDKKGYVDSVKNNGSIPSDTLTAKGIAKAPNGKDYASTMNSPLKYN
    Newman          DFKNKNLRLAIAQAIDKKGYVDSVKNNGSIPSDTLTAKGIAKAPNGKDYASTMNSPLKYN
    USA300_FPR3757  DFKNKNLRLAIAQAIDKKGYVDSVKNNGSIPSDTLTAKGIAKAPNGKDYASTMNSPLKYN
                    ************************************************************

    COL             PKEARAHWDKAKKELGKNEVTFSMNTEDTPDAKISAEYIKSQVEKNLPGVTLKIKQLPFK
    N315            PKEARAHWDKAKKELGKNEVTFSMNTEDTPDAKISAEYIKSQVEKNLPGVTLKIKQLPFK
    NCTC8325        PKEARAHWDKAKKELGKNEVTFSMNTEDTPDAKISAEYIKSQVEKNLPGVTLKIKQLPFK
    Newman          PKEARAHWDKAKKELGKNEVTFSMNTEDTPDAKISAEYIKSQVEKNLPGVTLKIKQLPFK
    USA300_FPR3757  PKEARAHWDKAKKELGKNEVTFSMNTEDTPDAKISAEYIKSQVEKNLPGVTLKIKQLPFK
                    ************************************************************

    COL             QRVSLELSNNFEASLSGWSADYPDPMAYLETMTTGSAQNNTDWGNKEYDQLLKVARTKLA
    N315            QRVSLELSNNFEASLSGWSADYPDPMAYLETMTTGSAQNNTDWGNKEYDQLLKVARTKLA
    NCTC8325        QRVSLELSNNFEASLSGWSADYPDPMAYLETMTTGSAQNNTDWGNKEYDQLLKVARTKLA
    Newman          QRVSLELSNNFEASLSGWSADYPDPMAYLETMTTGSAQNNTDWGNKEYDQLLKVARTKLA
    USA300_FPR3757  QRVSLELSNNFEASLSGWSADYPDPMAYLETMTTGSAQNNTDWGNKEYDQLLKVARTKLA
                    ************************************************************

    COL             LQPNERYENLKKAEEMFLGDAPVAPIYQKGVAHLTNPQVKGLIYHKFGPNNSLKHVYIDK
    N315            LQPNERYENLKKAEEMFLGDAPVAPIYQKGVAHLTNPQVKGLIYHKFGPNNSLKHVYIDK
    NCTC8325        LQPNERYENLKKAEEMFLGDAPVAPIYQKGVAHLTNPQVKGLIYHKFGPNNSLKHVYIDK
    Newman          LQPNERYENLKKAEEMFLGDAPVAPIYQKGVAHLTNPQVKGLIYHKFGPNNSLKHVYIDK
    USA300_FPR3757  LQPNERYENLKKAEEMFLGDAPVAPIYQKGVAHLTNPQVKGLIYHKFGPNNSLKHVYIDK
                    ************************************************************

    COL             SIDKETGKKKK
    N315            SIDKETGKKKK
    NCTC8325        SIDKETGKKKK
    Newman          SIDKETGKKKK
    USA300_FPR3757  SIDKETGKKKK
                    ***********