From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003149000
  • symbol?: opp-4D
  • description?: oligopeptide ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • oligopeptide ABC transporter ATP-binding protein
    • peptide ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein
    • Oligopeptide transport ATP-binding protein OppD
    • putative oligopeptide transport ATP-binding protein
    • oligopeptide/dipeptide ABC transporter, ATP-binding , C-terminal domain protein
    • oligopeptide/dipeptide ABC transporter ATPase
    • oligopeptide ABC superfamily ATP binding cassette transporter, ABC protein
    • oligopeptide ABC transporter, ATP-binding protein
    • Oligopeptide ABC transporter, ATP-binding protein, putative
    • oligopeptide transport ATP-binding protein
    • putative peptide ABC transporter ATP-binding protein y4tR
  • strand?: +
  • coordinates?: 3534388..3535617
  • synteny block?: BlockID0022380
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0862 (appF)
    USA300_FPR3757:
    04-02981:
    SA2981_0947 (oppD)
    08BA02176:
    11819-97:
    MS7_0948
    71193:
    ECT-R 2:
    ECTR2_847
    ED133:
    SAOV_0938
    ED98:
    SAAV_0953
    HO 5096 0412:
    SAEMRSA15_08210 (appD)
    JH1:
    SaurJH1_1010
    JH9:
    SaurJH9_0991
    JKD6008:
    SAA6008_00945
    JKD6159:
    LGA251:
    SARLGA251_09080 (appD)
    M013:
    M013TW_0914
    MRSA252:
    SAR0957 (appD)
    MSHR1132:
    SAMSHR1132_08400
    MSSA476:
    SAS0862
    Mu3:
    SAHV_0987
    Mu50:
    SAV0992
    MW2:
    MW0874
    RF122:
    ST398:
    T0131:
    SAT0131_01025
    TCH60:
    HMPREF0772_12250 (dppD)
    TW20:
    SATW20_09900 (appD)
    USA300_TCH1516:
    USA300HOU_0950 (oppD2)
    VC40:
    SAVC_04130

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNVLLEVKDLETSLKINNEWLATVENISFELSKGEVLGIVGESGCGKSILSKSIIKLLP
    N315            MNNVLLEVKDLETSLKINNEWLATVENISFELSKGEVLGIVGESGCGKSILSKSIIKLLP
    NCTC8325        MNNVLLEVKDLETSLKINNEWLATVENISFELSKGEVLGIVGESGCGKSILSKSIIKLLP
    Newman          MNNVLLEVKDLETSLKINNEWLATVENISFELSKGEVLGIVGESGCGKSILSKSIIKLLP
    USA300_FPR3757  MNNVLLEVKDLETSLKINNEWLATVENISFELSKGEVLGIVGESGCGKSILSKSIIKLLP
                    ************************************************************

    COL             EKISKLSNGEVIFDGKRIDTLNEKQLLDIRGNDIAMIFQEPMTALNPVFTIKNQLVESIK
    N315            EKISKLSSGEVIFDGKRIDTLNEKQLLDIRGNDIAMIFQEPMTALNPVFTIKNQLVESIK
    NCTC8325        EKISKLSNGEVIFDGKRIDTLNEKQLLDIRGNDIAMIFQEPMTALNPVFTIKNQLVESIK
    Newman          EKISKLSNGEVIFDGKRIDTLNEKQLLDIRGNDIAMIFQEPMTALNPVFTIKNQLVESIK
    USA300_FPR3757  EKISKLSNGEVIFDGKRIDTLNEKQLPDIRGNDIAMIFQEPMTALNPVFTIKNQLVESIK
                    *******.****************** *********************************

    COL             SHKKISKKEANKLAKDLLKKVGIARQDEILNSYPHQLSGGMRQRVMIAMAISCSPKLLIA
    N315            SHKKISKKEANNLAKDLLKKVGIARQDEILNSYPHQLSGGMRQRVMIAMAISCSPKLLIA
    NCTC8325        SHKKISKKEANKLAKDLLKKVGIARQDEILNSYPHQLSGGMRQRVMIAMAISCSPKLLIA
    Newman          SHKKISKKEANKLAKDLLKKVGIARQDEILNSYPHQLSGGMRQRVMIAMAISCSPKLLIA
    USA300_FPR3757  SHKKISKKEANKLAKDLLKKVGIARQDEILNSYPHQLSGGMRQRVMIAMAISCSPKLLIA
                    ***********:************************************************

    COL             DEPTTALDVTIQAQILDLLKELQKETQMAIMMITHDLSVVAEFCDKVLVMYAGQIVEFGG
    N315            DEPTTALDVTIQAQILDLLKELQKETQMAIMMITHDLSVVAEFCDKVLVMYAGQIVEFGG
    NCTC8325        DEPTTALDVTIQAQILDLLKELQKETQMAIMMITHDLSVVAEFCDKVLVMYAGQIVEFGG
    Newman          DEPTTALDVTIQAQILDLLKELQKETQMAIMMITHDLSVVAEFCDKVLVMYAGQIVEFGG
    USA300_FPR3757  DEPTTALDVTIQAQILDLLKELQKETQMAIMMITHDLSVVAEFCDKVLVMYAGQIVEFGG
                    ************************************************************

    COL             IKEILHNPKHPYTQKLLSTIPKLKEEQKRLETIEGIVPSIQAFHVNKCRFANRCNKKLDI
    N315            IKEILHNPKHPYTQKLLSTIPKLKEGQKRLETIEGIVPSIQAFHVNKCRFANRCNKKLDI
    NCTC8325        IKEILHNPKHPYTQKLLSTIPKLKEEQKRLETIEGIVPSIQAFHVNKCRFANRCNKKLDI
    Newman          IKEILHNPKHPYTQKLLSTIPKLKEEQKRLETIEGIVPSIQAFHVNKCRFANRCNKKLDI
    USA300_FPR3757  IKEILHNPKHPYTQKLLSTIPKLKEEQKRLETIEGIVPSIQAFHVNKCRFANRCNKKLDI
                    ************************* **********************************

    COL             CNNQSPKMHVCEDVIVRCHLYKNEYKEI
    N315            CNNQSPKMHVCEDVIVRCHLYKNEYKEI
    NCTC8325        CNNQSPKMHVCEDVIVRCHLYKNEYKEI
    Newman          CNNQSPKMHVCEDVIVRCHLYKNEYKEI
    USA300_FPR3757  CNNQSPKMHVCEDVIVRCHLYKNEYKEI
                    ****************************