From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003179000
  • symbol?:
  • description?: ribosomal large subunit pseudouridine synthase D

      descriptions from strain specific annotations:

    • ribosomal large subunit pseudouridine synthase D
    • RluA family pseudouridine synthase
    • RNA pseudouridylate synthase family protein
    • putative RNA pseudouridylate synthase
    • RluD subfamily ribosomal large subunit pseudouridine synthase
    • Pseudouridine synthase
    • RNA pseudoridylate synthase
    • ribosomal large subunitpseudouridine synthase D-like protein
    • ribosomal large subunit pseudouridine synthase, RluD subfamily
  • strand?: +
  • coordinates?: 3569357..3570212
  • synteny block?: BlockID0022660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0962 (yjbO)
    08BA02176:
    C248_1030
    11819-97:
    MS7_0963
    71193:
    ST398NM01_1003
    ECT-R 2:
    ECTR2_862
    ED133:
    SAOV_0953
    ED98:
    SAAV_0970
    HO 5096 0412:
    SAEMRSA15_08380
    JH1:
    SaurJH1_1025
    JH9:
    SaurJH9_1006
    JKD6008:
    SAA6008_00961 (rluA1)
    JKD6159:
    SAA6159_00864 (rluA1)
    LGA251:
    SARLGA251_09230
    M013:
    M013TW_0930
    MRSA252:
    SAR0975
    MSHR1132:
    SAMSHR1132_08550
    MSSA476:
    SAS0877
    Mu3:
    SAHV_1002
    Mu50:
    SAV1008
    MW2:
    MW0889
    RF122:
    SAB0874
    ST398:
    SAPIG1003
    T0131:
    SAT0131_01043
    TCH60:
    HMPREF0772_12229
    TW20:
    SATW20_10050
    USA300_TCH1516:
    USA300HOU_0965 (rluA1)
    VC40:
    SAVC_04205

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFKYHISQQETVKTFLARHDFSKKTVSAIKNNGALIVNDEPVTVRKQLMTNDILEIHLP
    N315            MKFKYHISQQETVKAFLARHDFSKKTVSAIKNNGALIVNDEPVTVRKQLMPNDILEIHLP
    NCTC8325        MKFKYHISQQETVKTFLARHDFSKKTVSAIKNNGALIVNDEPVTVRKQLMTNDILEIHLP
    Newman          MKFKYHISQQETVKTFLARHDFSKKTVSAIKNNGALIVNDEPVTVRKQLMTNDILEIHLP
    USA300_FPR3757  MKFKYHISQQETVKTFLARHDFSKKTVSAIKNNGALIVNDEPVTVRKQLMTNDILEIHLP
                    **************:***********************************.*********

    COL             REIPSVNLIPYARKLEVLYEDAFIIIVTKPNNQNCTPSREHPHESLIEQVLYHCQEHGEN
    N315            REIPSVNLIPYARKLEVLYEDAFIIIVTKPNNQNCTPSREHPHESLIEQVLYHCQEHGEN
    NCTC8325        REIPSVNLIPYARKLEVLYEDAFIIIVTKPNNQNCTPSREHPHESLIEQVLYHCQEHGEN
    Newman          REIPSVNLIPYARKLEVLYEDAFIIIVTKPNNQNCTPSREHPHESLIEQVLYHCQEHGEN
    USA300_FPR3757  REIPSVNLIPYARKLEVLYEDAFIIIVTKPNNQNCTPSREHPHESLIEQVLYHCQEHGEN
                    ************************************************************

    COL             INPHIVTRLDRNTTGIVIFAKYGHIHHLFSKVNLKKIYTCLVYGKTHTSGIIEANIRRSK
    N315            INPHIVTRLDRNTTGIVIFAKYGHIHHLFSKVNLKKIYTCLVYGKTHTSGIIEANIRRSK
    NCTC8325        INPHIVTRLDRNTTGIVIFAKYGHIHHLFSKVNLKKIYTCLVYGKTHTSGIIEANIRRSK
    Newman          INPHIVTRLDRNTTGIVIFAKYGHIHHLFSKVNLKKIYTCLVYGKTHTSGIIEANIRRSK
    USA300_FPR3757  INPHIVTRLDRNTTGIVIFAKYGHIHHLFSKVNLKKIYTCLVYGKTHTSGIIEANIRRSK
                    ************************************************************

    COL             DRIITREVASDGKYAKTSYEVINQNDKYSLCKVHLHTGRTHQIRVHFQHIGHPIVGDSLY
    N315            DSIITREVASDGKYAKTSYEVINQNDKYSLCKVHLHTGRTHQIRVHFQHIGHPIVGDSLY
    NCTC8325        DRIITREVASDGKYAKTSYEVINQNDKYSLCKVHLHTGRTHQIRVHFQHIGHPIVGDSLY
    Newman          DRIITREVASDGKYAKTSYEVINQNDKYSLCKVHLHTGRTHQIRVHFQHIGHPIVGDSLY
    USA300_FPR3757  DRIITREVASDGKYAKTSYEVINQNDKYSLCKVHLHTGRTHQIRVHFQHIGHPIVGDSLY
                    * **********************************************************

    COL             DGFHDKIHGQVLQCTQIYFVHPINKNNIYITIDYKQLLKLFNQL
    N315            DGFHDKIHGQVLQCTQIYFVHPINKNNIYITIDYKQLLKLFNQL
    NCTC8325        DGFHDKIHGQVLQCTQIYFVHPINKNNIYITIDYKQLLKLFNQL
    Newman          DGFHDKIHGQVLQCTQIYFVHPINKNNIYITIDYKQLLKLFNQL
    USA300_FPR3757  DGFHDKIHGQVLQCTQIYFVHPINKNNIYITIDYKQLLKLFNQL
                    ********************************************