From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003187000
  • symbol?:
  • description?: alanine:cation symporter family protein

      descriptions from strain specific annotations:

    • alanine:cation symporter family protein
    • sodium:alanine symporter family protein
    • Na+/alanine symporter family protein
    • sodium/proton-dependent alanine carrier protein
    • AGCS family alanine or glycine:sodium (Na+) or proton (H+) symporter
    • amino acid carrier family protein
    • amino acid carrier protein
    • amino-acid carrier protein alsT
    • Sodium/alanine symporter
    • sodium/alanine symporter family protein
  • strand?: +
  • coordinates?: 3577965..3579593
  • synteny block?: BlockID0022740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0967
    08BA02176:
    C248_1037
    11819-97:
    MS7_0968
    71193:
    ST398NM01_1008
    ECT-R 2:
    ECTR2_867 (agcS)
    ED133:
    SAOV_0958
    ED98:
    SAAV_0975
    HO 5096 0412:
    SAEMRSA15_08430
    JH1:
    SaurJH1_1030
    JH9:
    SaurJH9_1011
    JKD6008:
    SAA6008_00967 (alsT)
    JKD6159:
    SAA6159_00869 (alsT)
    LGA251:
    SARLGA251_09280
    M013:
    M013TW_0935
    MRSA252:
    SAR0980
    MSHR1132:
    SAMSHR1132_08600
    MSSA476:
    SAS0882
    Mu3:
    SAHV_1007
    Mu50:
    SAV1013
    MW2:
    MW0894
    RF122:
    SAB0879
    ST398:
    SAPIG1008
    T0131:
    SAT0131_01047
    TCH60:
    HMPREF0772_12223
    TW20:
    SATW20_10100
    USA300_TCH1516:
    USA300HOU_0971
    VC40:
    SAVC_04230

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------------MIEKLVTFLNEVVWSKPLVYGLLITGVLFTLRMRFFQVRH
    N315            -----------------------------------------MLITGVLFTLRMRFFQVRH
    NCTC8325        --------------------MIEKLVTFLNEVVWSKPLVYGLLITGVLFTLRMRFFQVRH
    Newman          MKCLVLNRIIFLCLNNRGNLMIEKLVTFLNEVVWSKPLVYGLLITGVLFTLRMRFFQVRH
    USA300_FPR3757  --------------------MIEKLVTFLNEVVWSKPLVYGLLITGVLFTLRMRFFQVRH
                                                             :******************

    COL             FKEMIRLMFQGEKSPNGISSFQAIAMSLAGRVGTGNIVGVSTAIFIGGPGAVFWMWITAF
    N315            FKEMIRLMFQGEKSPNGISSFQAIAMSLAGRVGTGNIVGVSTAIFIGGPGAVFWMWITAF
    NCTC8325        FKEMIRLMFQGEKSPNGISSFQAIAMSLAGRVGTGNIVGVSTAIFIGGPGAVFWMWITAF
    Newman          FKEMIRLMFQGEKSPNGISSFQAIAMSLAGRVGTGNIVGVSTAIFIGGPGAVFWMWITAF
    USA300_FPR3757  FKEMIRLMFQGEKSPNGISSFQAIAMSLAGRVGTGNIVGVSTAIFIGGPGAVFWMWITAF
                    ************************************************************

    COL             LGASSAFIESTLGQIFKRVENNEYRGGPAYYIEYGIGGKFGKIYGIIFAIVTIISVGLLL
    N315            LGASSAFIESTLGQIFKRVENNEYRGGPAYYIEYGIGGKFGKIYGIIFAIVTIISVGLLL
    NCTC8325        LGASSAFIESTLGQIFKRVENNEYRGGPAYYIEYGIGGKFGKIYGIIFAIVTIISVGLLL
    Newman          LGASSAFIESTLGQIFKRVENNEYRGGPAYYIEYGIGGKFGKIYGIIFAIVTIISVGLLL
    USA300_FPR3757  LGASSAFIESTLGQIFKRVENNEYRGGPAYYIEYGIGGKFGKIYGIIFAIVTIISVGLLL
                    ************************************************************

    COL             PGVQSNAIASSMHNAIHVPQWLMGGIVVVILGLIIFGGVRSIANVATAVVPFMAIIYILM
    N315            PGVQSNAIASSMHNAIHVPQWLMGAIVVVILGLIIFGGVRSIANVATAVVPFMAIIYILM
    NCTC8325        PGVQSNAIASSMHNAIHVPQWLMGGIVVVILGLIIFGGVRIIANVATAVVPFMAIIYILM
    Newman          PGVQSNAIASSMHNAIHVPQWLMGGIVVVILGLIIFGGVRSIANVATAVVPFMAIIYILM
    USA300_FPR3757  PGVQSNAIASSMHNAIHVPQWLMGGIVVVILGLIIFGGVRSIANVATAVVPFMAIIYILM
                    ************************.*************** *******************

    COL             AVIIICINIQEVPALFALIFKSAFGLQSAFGGIVGAMIEIGVKRGLYSNEAGQGTGPHAA
    N315            AVIIICINIQEVPALFALIFKSAFGLQSAFGGIVGAMIEIGVKRGLYSNEAGQGTGPHAA
    NCTC8325        AVIIICINIQEVPALFALIFKSAFGLQSAFGGIVGAMIEIGVKRGLYSNEAGQGTGPHAA
    Newman          AVIIICINIQEVPALFALIFKSAFGLQSAFGGIVGAMIEIGVKRGLYSNEAGQGTGPHAA
    USA300_FPR3757  AVIIICINIQEVPALFALIFKSAFGLQSAFGGIVGAMIEIGVKRGLYSNEAGQGTGPHAA
                    ************************************************************

    COL             AAAEVSHPSKQGLVQAFSVYIDTLFVCTATALIILISGTYNVTDGTVNANGTPHLIKDGG
    N315            AAAEVSHPSKQGLVQAFSVYIDTLFVCTATALIILISGTYNVTDGTVNANGTPHLIKDGG
    NCTC8325        AAAEVSHPSKQGLVQAFSVYIDTLFVCTATALIILISGTYNVTDGTVNANGTPHLIKDGG
    Newman          AAAEVSHPSKQGLVQAFSVYIDTLFVCTATALIILISGTYNVTDGTVNANGTPHLIKDGG
    USA300_FPR3757  AAAEVSHPSKQGLVQAFSVYIDTLFVCTATALIILISGTYNVTDGTVNANGTPHLIKDGG
                    ************************************************************

    COL             IYVENATGKDYSGTAMYAQAGIDKAFHGSGYQFDPTFSGVGSYFIAFALFFFAFTTILSY
    N315            IYVENATGKDYSGTAMYAQAGIDKAFHGSGYQFDPTFSGVGSYFIAFALFFFAFTTILSY
    NCTC8325        IYVENATGKDYSGTAMYAQAGIDKAFHGSGYQFDPTFSGVGSYFIAFALFFFAFTTILSY
    Newman          IYVENATGKDYSGTAMYAQAGIDKAFHGSGYQFDPTFSGVGSYFIAFALFFFAFTTILSY
    USA300_FPR3757  IYVENATGKDYSGTAMYAQAGIDKAFHGSGYQFDPTFSGVGSYFIAFALFFFAFTTILSY
                    ************************************************************

    COL             YYITETNVAYLTRNQNNQVSSIFINIARVIILFATFYGAVKTADVAWAFGDLGVGLMAWL
    N315            YYITETNVAYLTRNQNNQVSSIFINIARVIILFATFYGAVKTADVAWAFGDLGVGLMAWL
    NCTC8325        YYITETNVAYLTRNQNNQVSSIFINIARVIILFATFYGAVKTADVAWAFGDLGVGLMAWL
    Newman          YYITETNVAYLTRNQNNQVSSIFINIARVIILFATFYGAVKTADVAWAFGDLGVGLMAWL
    USA300_FPR3757  YYITETNVAYLTRNQNNQVSSIFINIARVIILFATFYGAVKTADVAWAFGDLGVGLMAWL
                    ************************************************************

    COL             NIIAIWILHKPAVNALKDYEIQKKRLGNGYNAVYQPDPNKLPNAVFWLKTYPERLKQARA
    N315            NIIAIWILHKPAVNALKDYEIQKKRLGNGYNAVYQPDPNKLPNAVFWLKTYPERLKQARA
    NCTC8325        NIIAIWILHKPAVNALKDYEIQKKRLGNGYNAVYQPDPNKLPNAVFWLKTYPERLKQARA
    Newman          NIIAIWILHKPAVNALKDYEIQKKRLGNGYNAVYQPDPNKLPNAVFWLKTYPERLKQARA
    USA300_FPR3757  NIIAIWILHKPAVNALKDYEIQKKRLGNGYNAVYQPDPNKLPNAVFWLKTYPERLKQARA
                    ************************************************************

    COL             KK
    N315            KK
    NCTC8325        KK
    Newman          KK
    USA300_FPR3757  KK
                    **