From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003193000
  • symbol?: ltaA
  • description?: major facilitator transporter

      descriptions from strain specific annotations:

    • major facilitator transporter
    • major facilitator superfamily transporter
    • MFS family major facilitator transporter
    • Glycolipid permease ltaA
    • putative glycolipid permease ltaA
    • MFS-type transporter
    • Permease
    • membrane protein
  • strand?: -
  • coordinates?: 3585331..3586113
  • synteny block?: BlockID0022800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0970
    08BA02176:
    C248_1040
    11819-97:
    MS7_0971 (ltaA)
    71193:
    ST398NM01_1011
    ECT-R 2:
    ECTR2_870
    ED133:
    SAOV_0961c
    ED98:
    SAAV_0978
    HO 5096 0412:
    SAEMRSA15_08460
    JH1:
    SaurJH1_1033
    JH9:
    SaurJH9_1014
    JKD6008:
    SAA6008_00971
    JKD6159:
    SAA6159_00872
    LGA251:
    SARLGA251_09310
    M013:
    M013TW_0940
    MRSA252:
    SAR0986
    MSHR1132:
    SAMSHR1132_08630
    MSSA476:
    SAS0885
    Mu3:
    SAHV_1010
    Mu50:
    SAV1016
    MW2:
    MW0897
    RF122:
    SAB0882c
    ST398:
    SAPIG1011
    T0131:
    SAT0131_01051
    TCH60:
    HMPREF0772_12218
    TW20:
    SATW20_10130
    USA300_TCH1516:
    USA300HOU_0974
    VC40:
    SAVC_04245

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------MQDSSLNNYANHKNFILMLIILFLMEFARGMYILSYINFLPTVTSIAVAITSLA
    N315            ------MQDSSLNNYANHKNFILMLIILFLMEFARGMYILSYINFLPTVTSIAVAITSLA
    NCTC8325        MERFLYMQDSSLNNYANHKNFILMLIILFLMEFARGMYILSYINFLPTVTSIAVAITSLA
    Newman          ------MQDSSLNNYANHKNFILMLIILFLMEFARGMYILSYINFLPTVTSIAVAITSLA
    USA300_FPR3757  MERFLYMQDSSLNNYANHKNFILMLIILFLMEFARGMYILSYINFLPTVTSIAVAITSLA
                          ******************************************************

    COL             FSIHFIADASTNFVIGFLLKKFGTKIVLTTGFILAFTSLFLVIWFPASPFVIIFSAMMLG
    N315            FSIHFIADASTNFVIGFLLKKFGTKIVLTTGFILAFTSLFLVIWFPASPFVIIFSAMMLG
    NCTC8325        FSIHFIADASTNFVIGFLLKKFGTKIVLTTGFILAFTSLFLVIWFPASPFVIIFSAMMLG
    Newman          FSIHFIADASTNFVIGFLLKKFGTKIVLTTGFILAFTSLFLVIWFPASPFVIIFSAMMLG
    USA300_FPR3757  FSIHFIADASTNFVIGFLLKKFGTKIVLTTGFILAFTSLFLVIWFPASPFVIIFSAMMLG
                    ************************************************************

    COL             IAVSPIWVIMLSSVEEDKRGKQMGYVYFSWLLGLLVGMVFMNLLIKVHPTRFAFMMSLVV
    N315            IAVSPIWVIMLSSVEEDKRGKQMGYVYFSWLLGLLVGMVFMNLLIKVHPTRFAFMMSLVV
    NCTC8325        IAVSPIWVIMLSSVEEDKRGKQMGYVYFSWLLGLLVGMVFMNLLIKVHPTRFAFMMSLVV
    Newman          IAVSPIWVIMLSSVEEDKRGKQMGYVYFSWLLGLLVGMVFMNLLIKVHPTRFAFMMSLVV
    USA300_FPR3757  IAVSPIWVIMLSSVEEDKRGKQMGYVYFSWLLGLLVGMVFMNLLIKVHPTRFAFMMSLVV
                    ************************************************************

    COL             LIAWILYYFVDVKLTNYNTRPVKAQLRQIVDVTKRHLLLFPGILLQGAAIAALVPILPTY
    N315            LIAWILYYFVDVKLTNYNTRPVKAQLRQIVDVTKRHLLLFPGILLQGAAIAALVPILPTY
    NCTC8325        LIAWILYYFVDVKLTNYNTRPVKAQLRQIVDVTKRHLLLFPGILLQGAAIAALVPILPTY
    Newman          LIAWILYYFVDVKLTNYNTRPVKAQLRQIVDVTKRHLLLFPGILLQGAAIAALVPILPTY
    USA300_FPR3757  LIAWILYYFVDVKLTNYNTRPVKAQLRQIVDVTKRHLLLFPGILLQGAAIAALVPILPTY
                    ************************************************************

    COL             ATKVINVSTIEYTVAIIIGGIGCAVSMLFLSKLIDNRSRNFMYGVILSGFILYMILIFTL
    N315            ATKVINVSTIEYTVAIIIGGIGCAVSMLFLSKLIDNRSRNFMYGVILSGFILYMILIFTL
    NCTC8325        ATKVINVSTIEYTVAIIIGGIGCAVSMLFLSKLIDNRSRNFMYGVILSGFILYMILIFTL
    Newman          ATKVINVSTIEYTVAIIIGGIGCAVSMLFLSKLIDNRSRNFMYGVILSGFILYMILIFTL
    USA300_FPR3757  ATKVINVSTIEYTVAIIIGGIGCAVSMLFLSKLIDNRSRNFMYGVILSGFILYMILIFTL
                    ************************************************************

    COL             SMIVNIHILWIIALAIGLMYGILLPAWNTFMARFIKSDEQEETWGVFNSIQGFGSMIGPL
    N315            SMIVNIHIVWIIALAIGLMYGILLPAWNTFMARFIKSDEQEETWGVFNSIQGFGSMIGPL
    NCTC8325        SMIVNIHILWIIALAIGLMYGILLPAWNTFMARFIKSDEQEETWGVFNSIQGFGSMIGPL
    Newman          SMIVNIHILWIIALAIGLMYGILLPAWNTFMARFIKSDEQEETWGVFNSIQGFGSMIGPL
    USA300_FPR3757  SMIVNIHILWIIALAIGLMYGILLPAWNTFMARFIKSDEQEETWGVFNSIQGFGSMIGPL
                    ********:***************************************************

    COL             FGGLITQFTNNLNNTFYFSALIFLVLAVFYGSYFIVNREKAK
    N315            FGGLITQFTNDLNNTFYFSALIFLVLAVFYGSYFIANREKAK
    NCTC8325        FGGLITQFTNNLNNTFYFSALIFLVLAVFYGSYFIVNREKAK
    Newman          FGGLITQFTNNLNNTFYFSALIFLVLAVFYGSYFIVNREKAK
    USA300_FPR3757  FGGLITQFTNNLNNTFYFSALIFLVLAVFYGSYFIVNREKAK
                    **********:************************.******