From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003201000
  • symbol?:
  • description?: toxic anion resistance protein

      descriptions from strain specific annotations:

    • toxic anion resistance protein
    • TerC family membrane protein
    • integral membrane protein TerC
    • toxic anion resistance protein homologue
    • integral membrane protein TerC family protein
    • toxic anion resistance membrane protein
    • Tellurite resistance protein
    • TerC family integral membrane protein
  • strand?: +
  • coordinates?: 3591761..3592570
  • synteny block?: BlockID0022880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0975
    08BA02176:
    C248_1044
    11819-97:
    MS7_0977
    71193:
    ST398NM01_1017
    ECT-R 2:
    ECTR2_876
    ED133:
    SAOV_0965
    ED98:
    SAAV_0984
    HO 5096 0412:
    SAEMRSA15_08510
    JH1:
    SaurJH1_1038
    JH9:
    SaurJH9_1019
    JKD6008:
    SAA6008_00976 (terC)
    JKD6159:
    SAA6159_00877 (terC)
    LGA251:
    SARLGA251_09360
    M013:
    M013TW_0946
    MRSA252:
    SAR0991
    MSHR1132:
    SAMSHR1132_08680
    MSSA476:
    SAS0890
    Mu3:
    SAHV_1015
    Mu50:
    SAV1022
    MW2:
    MW0902
    RF122:
    SAB0887
    ST398:
    SAPIG1017
    T0131:
    SAT0131_01056
    TCH60:
    HMPREF0772_12213
    TW20:
    SATW20_10180
    USA300_TCH1516:
    USA300HOU_0979
    VC40:
    SAVC_04270

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLMDPSLILPYLWVLVVLVFLEGLLAADNAIVMAVMVKHLPPEQRKKALFYGLLGAFVFR
    N315            MLMDPSLILPYLWVLVVLVFLEGLLAADNAIVMAVMVKHLPPEQRKKALFYGLLGAFVFR
    NCTC8325        MLMDPSLILPYLWVLVVLVFLEGLLAADNAIVMAVMVKHLPPEQRKKALFYGLLGAFVFR
    Newman          MLMDPSLILPYLWVLVVLVFLEGLLAADNAIVMAVMVKHLPPEQRKKALFYGLLGAFVFR
    USA300_FPR3757  MLMDPSLILPYLWVLVVLVFLEGLLAADNAIVMAVMVKHLPPEQRKKALFYGLLGAFVFR
                    ************************************************************

    COL             FLALFLISIIANFWFIQAAGAVYLIYMSIKNLWQFFKHPEIESPEAGDDHHYDESGEEIK
    N315            FLALFLISIIANFWFIQAAGAVYLIYMSIKNLWQFFKHPEIESPEAGDDHHYDESGEEIK
    NCTC8325        FLALFLISIIANFWFIQAAGAVYLIYMSIKNLWQFFKHPEIESPEAGDDHHYDESGEEIK
    Newman          FLALFLISIIANFWFIQAAGAVYLIYMSIKNLWQFFKHPEIESPEAGDDHHYDESGEEIK
    USA300_FPR3757  FLALFLISIIANFWFIQAAGAVYLIYMSIKNLWQFFKHPEIESPEAGDDHHYDESGEEIK
                    ************************************************************

    COL             ASNKSFWGTVLKIEFADIAFAIDSMLAALAIAVTLPKVGIHFGGMDLGQFVVMFLGGMIG
    N315            ASNKSFWGTVLKIEFADIAFAIDSMLAALAIAVTLPKVGIHFGGMDLGQFVVMFLGGMIG
    NCTC8325        ASNKSFWGTVLKIEFADIAFAIDSMLAALAIAVTLPKVGIHFGGMDLGQFVVMFLGGMIG
    Newman          ASNKSFWGTVLKIEFADIAFAIDSMLAALAIAVTLPKVGIHFGGMDLGQFVVMFLGGMIG
    USA300_FPR3757  ASNKSFWGTVLKIEFADIAFAIDSMLAALAIAVTLPKVGIHFGGMDLGQFVVMFLGGMIG
                    ************************************************************

    COL             VILMRYAATWFVELLNKYPGLEGAAFAIVGWVGVKLVVMVLAHPDIAVLPEHFPHGVLWQ
    N315            VILMRYAATWFVELLNKYPGLEGAAFAIVGWVGVKLVVMVLAHPDIAVLPEHFPHGVLWQ
    NCTC8325        VILMRYAATWFVELLNKYPGLEGAAFAIVGWVGVKLVVMVLAHPDIAVLPEHFPHGVLWQ
    Newman          VILMRYAATWFVELLNKYPGLEGAAFAIVGWVGVKLVVMVLAHPDIAVLPEHFPHGVLWQ
    USA300_FPR3757  VILMRYAATWFVELLNKYPGLEGAAFAIVGWVGVKLVVMVLAHPDIAVLPEHFPHGVLWQ
                    ************************************************************

    COL             SIFWTVLIGLVIIGWLGSVVKNKKSHK
    N315            SIFWTVLIGLVIIGWLGSVVKNKKSHK
    NCTC8325        SIFWTVLIGLVIIGWLGSVVKNKKSHK
    Newman          SIFWTVLIGLVIIGWLGSVVKNKKSHK
    USA300_FPR3757  SIFWTVLIGLVIIGWLGSVVKNKKSHK
                    ***************************