From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003206000
  • symbol?:
  • description?: 5'-nucleotidase domain-containing protein

      descriptions from strain specific annotations:

    • 5'-nucleotidase domain-containing protein
    • 5' nucleotidase family protein
    • 2,3-cyclic-nucleotide 2-phosphodiesterase
    • putative 5'-nucleotidase
  • strand?: +
  • coordinates?: 3596986..3598497
  • synteny block?: BlockID0022930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0978
    08BA02176:
    C248_1047
    11819-97:
    MS7_0980
    71193:
    ST398NM01_1020
    ECT-R 2:
    ECTR2_879
    ED133:
    SAOV_0968
    ED98:
    SAAV_0987
    HO 5096 0412:
    SAEMRSA15_08540
    JH1:
    SaurJH1_1105
    JH9:
    SaurJH9_1083
    JKD6008:
    SAA6008_00979
    JKD6159:
    SAA6159_00880
    LGA251:
    SARLGA251_09390
    M013:
    M013TW_0951
    MRSA252:
    SAR0994
    MSHR1132:
    SAMSHR1132_08710
    MSSA476:
    SAS0957
    Mu3:
    SAHV_1018
    Mu50:
    SAV1025
    MW2:
    MW0905
    RF122:
    SAB0890
    ST398:
    SAPIG1020
    T0131:
    SAT0131_01059 (manA1)
    TCH60:
    HMPREF0772_12210
    TW20:
    SATW20_10210
    USA300_TCH1516:
    USA300HOU_0982
    VC40:
    SAVC_04285

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MEKNENINVEILTTSDMHSHFLNGDYGSNIYRAGTYVNQVRAQNHRVILLDSGGSLAGS
    N315            MMEKNENINVEILTTSDMHSHFLNGDYGSNIYRAGTYVNQIRAQNHRVILLDSGGSLAGS
    NCTC8325        -MEKNENINVEILTTSDMHSHFLNGDYGSNIYRAGTYVNQVRAQNHRVILLDSGGSLAGS
    Newman          MMEKNENINVEILTTSDMHSHFLNGDYGSNIYRAGTYVNQVRAQNHRVILLDSGGSLAGS
    USA300_FPR3757  -MEKNENINVEILTTSDMHSHFLNGDYGSNIYRAGTYVNQVRAQNHRVILLDSGGSLAGS
                     ***************************************:*******************

    COL             LAAYYYAIVAPYKRHPMIKLMNRMHYDASGVSPSEFKFGLSFLTRSIALARFPWLSANIE
    N315            LAAYYYAIVAPYKRHPMIKLMNRMHYDASGVSPSEFKFGLSFLTRSIALARFPWLSANIE
    NCTC8325        LAAYYYAIVAPYKRHPMIKLMNRMHYDASGVSPSEFKFGLSFLTRSIALARFPWLSANIE
    Newman          LAAYYYAIVAPYKRHPMIKLMNRMHYDASGVSPSEFKFGLSFLTRSIALARFPWLSANIE
    USA300_FPR3757  LAAYYYAIVAPYKRHPMIKLMNRMHYDASGVSPSEFKFGLSFLTRSIALARFPWLSANIE
                    ************************************************************

    COL             YNVTKEPYFSTPYCIKHFGDLKIAIVGVTADGLMENEYSEMEQDVSIEKTLVASKRWIRY
    N315            YNVTKEPYFSTPYCIKHFGDLKIAIVGVTADGLMENEYSEMEQDVSIEKTLVASKRWIRY
    NCTC8325        YNVTKEPYFSTPYCIKHFGDLKIAIVGVTADGLMENEYSEMEQDVSIEKTLVASKRWIRY
    Newman          YNVTKEPYFSTPYCIKHFGDLKIAIVGVTADGLMENEYSEMEQDVSIEKTLVASKRWIRY
    USA300_FPR3757  YNVTKEPYFSTPYCIKHFGDLKIAIVGVTADGLMENEYSEMEQDVSIEKTLVASKRWIRY
                    ************************************************************

    COL             IHEVEEPDFLIVIYHGGLNKISNSTKNKKASSNEAEKLMEELGVIDLMITAHQHQTIVGQ
    N315            IHEVEEPDFLIVIYHGGLNKISNSTKNKKASSNEAEKLMEELGVIDLMITAHQHQTIVGQ
    NCTC8325        IHEVEEPDFLIVIYHGGLNKISNSTKNKKASSNEAEKLMEELGVIDLMITAHQHQTIVGQ
    Newman          IHEVEEPDFLIVIYHGGLNKISNSTKNKKASSNEAEKLMEELGVIDLMITAHQHQTIVGQ
    USA300_FPR3757  IHEVEEPDFLIVIYHGGLNKISNSTKNKKASSNEAEKLMEELGVIDLMITAHQHQTIVGQ
                    ************************************************************

    COL             DHETYYVQAGQDAKELVHLSINFKKRTTTYDVESIDSKVIDLNEYEEDQELLDLTFYDRK
    N315            DHETYYVQAGQDAKELVHLSINFKKRTTTYDVESIDSKVIDLNEYEEDQELLDLTFYDRK
    NCTC8325        DHETYYVQAGQDAKELVHLSINFKKRTTTYDVESIDSKVIDLNEYEEDQELLDLTFYDRK
    Newman          DHETYYVQAGQDAKELVHLSINFKKRTTTYDVESIDSKVIDLNEYEEDQELLDLTFYDRK
    USA300_FPR3757  DHETYYVQAGQDAKELVHLSINFKKRTTTYDVESIDSKVIDLNEYEEDQELLDLTFYDRK
                    ************************************************************

    COL             AVAYWSQEIISDKGLMLSVNGLQDLVCQTHPFSQLLHDAIHLAFDNDITCVHVPMNGEKG
    N315            AVAYWSQEIISDKGLMLSVNGLQDLVCQTHPFSQLLHDAIQLAFDNDITCVHVPMNGEKG
    NCTC8325        AVAYWSQEIISDKGLMLSVNGLQDLVCQTHPFSQLLHDAIHLAFDNDITCVHVPMNGEKG
    Newman          AVAYWSQEIISDKGLMLSVNGLQDLVCQTHPFSQLLHDAIHLAFDNDITCVHVPMNGEKG
    USA300_FPR3757  AVAYWSQEIISDKGLMLSVNGLQDLVCQTHPFSQLLHDAIHLAFDNDITCVHVPMNGEKG
                    ****************************************:*******************

    COL             LSGQIRNEDLYHAYPYPDKPMDMTISGQNIKDILEYSYSHLDFVNEQLSLTIIDETLCTM
    N315            LSGQIRNEDLYHAYPYPDKPMDMTISGQNIKDILEYSYSHLDFVNEQLSLTIIDETLCTM
    NCTC8325        LSGQIRNEDLYHAYPYPDKPMDMTISGQNIKDILEYSYSHLDFVNEQLSLTIIDETLCTM
    Newman          LSGQIRNEDLYHAYPYPDKPMDMTISGQNIKDILEYSYSHLDFVNEQLSLTIIDETLCTM
    USA300_FPR3757  LSGQIRNEDLYHAYPYPDKPMDMTISGQNIKDILEYSYSHLDFVNEQLSLTIIDETLCTM
                    ************************************************************

    COL             WQGFNYEIDMNQEPGQRVMLDQIDLTKSYRVTMTDYCYRNYKNYLKNAIIHESYDETMST
    N315            WQGFNYEIDMNQEPGQRVMLDQIDLTKSYRVTMTDYCYRNYKNYLKNAIIHESYDETMST
    NCTC8325        WQGFNYEIDMNQEPGQRVMLDQIDLTKSYRVTMTDYCYRNYKNYLKNAIIHESYDETMST
    Newman          WQGFNYEIDMNQEPGQRVMLDQIDLTKSYRVTMTDYCYRNYKNYLKNAIIHESYDETMST
    USA300_FPR3757  WQGFNYEIDMNQEPGQRVMLDQIDLTKSYRVTMTDYCYRNYKNYLKNAIIHESYDETMST
                    ************************************************************

    COL             LIAEKLRDPNYRISCSDNFIVKNR
    N315            LIAEKLRDPNYRISCSDNFVVKNR
    NCTC8325        LIAEKLRDPNYRISCSDNFIVKNR
    Newman          LIAEKLRDPNYRISCSDNFIVKNR
    USA300_FPR3757  LIAEKLRDPNYRISCSDNFIVKNR
                    *******************:****