From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003215000
  • symbol?:
  • description?: abortive infection protein

      descriptions from strain specific annotations:

    • abortive infection protein
    • protease, putative
    • CAAX amino terminal protease family protein
    • CAAX amino terminal protease self- immunity family protein
    • Abortive infection family protein
    • metal-dependent membrane protease
    • membrane protein
  • strand?: +
  • coordinates?: 3601466..3602068
  • synteny block?: BlockID0023010
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0983
    08BA02176:
    C248_1054
    11819-97:
    MS7_0987
    71193:
    ST398NM01_1027
    ECT-R 2:
    ECTR2_886
    ED133:
    SAOV_0975
    ED98:
    SAAV_0994
    HO 5096 0412:
    SAEMRSA15_08590
    JH1:
    SaurJH1_1110
    JH9:
    SaurJH9_1088
    JKD6008:
    SAA6008_00984
    JKD6159:
    SAA6159_00885
    LGA251:
    SARLGA251_09440
    M013:
    M013TW_0958
    MRSA252:
    SAR0999
    MSHR1132:
    SAMSHR1132_08760
    MSSA476:
    SAS0962
    Mu3:
    SAHV_1023
    Mu50:
    SAV1030
    MW2:
    MW0910
    RF122:
    SAB0894
    ST398:
    SAPIG1027
    T0131:
    SAT0131_01064
    TCH60:
    HMPREF0772_12205
    TW20:
    SATW20_10260
    USA300_TCH1516:
    VC40:
    SAVC_04310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKISKALTWFIISFIIFHLILFIMWGEHQEYWYLYTGIMLIAGISYVFYQRDIESNRLL
    N315            MNKISKALTWFIISFIIFHLILFIMWGEHQEYWYLYTGIMLIAGISYVFYQRDIESKRLL
    NCTC8325        MNKISKALTWFIISFIIFHLILFIMWGEHQEYWYLYTGIMLIAGISYVFYQRDIESKRLL
    Newman          MNKISKALTWFIISFIIFHLILFIMWGEHQEYWYLYTGIMLIAGISYVFYQRDIESKRLL
    USA300_FPR3757  MNKISKALTWFIISFIIFHLILFIMWGEHQEYWYLYTGIMLIAGISYVFYQRDIESKRLL
                    ********************************************************:***

    COL             TSIGVGIITAIILIMLQLLFSLITSNLSYSSLIKELARTGVNWKWQMLVTLLFVIPCHEL
    N315            TSIGVGIITAIILIMLQLLFSLITSNLSYSSLIKELARTGVNWKWQMLVTLLFVIPCHEL
    NCTC8325        TSIGVGIITAIILIMLQLLFSLITSNLSYSSLIKELARTGVNWKWQMLVTLLFVIPCHEL
    Newman          TSIGVGIITAIILIMLQLLFSLITSNLSYSSLIKELARTGVNWKWQMLVTLLFVIPCHEL
    USA300_FPR3757  TSIGVGIITAIILIMLQLLFSLITSNLSYSSLIKELARTGVNWKWQMLVTLLFVIPCHEL
                    ************************************************************

    COL             YMRTVLQKELTHFSIPKWVAILITAICSSSLFIYLDNWWIVTFIFVAQVILSLSYEYTRR
    N315            YMRTVLQKELTHFSIPKWIAILITAICSSSLFIYLDNWWIVTFIFVAQVILSLSYEYTRR
    NCTC8325        YMRTVLQKELTHFSIPKWVAILITAICSSSLFIYLDNWWIVTFIFVAQVILSLSYEYTRR
    Newman          YMRTVLQKELTHFSIPKWVAILITAICSSSLFIYLDNWWIVTFIFVAQVILSLSYEYTRR
    USA300_FPR3757  YMRTVLQKELTHFSIPKWVAILITAICSSSLFIYLDNWWIVTFIFVAQVILSLSYEYTRR
                    ******************:*****************************************

    COL             IATTSVAQIVAIILLLIFNA
    N315            IATTSVAQIVAIILLLIFNA
    NCTC8325        IATTSVAQIVAIILLLIFNA
    Newman          IATTSVAQIVAIILLLIFNA
    USA300_FPR3757  IATTSVAQIVAIILLLIFNA
                    ********************