From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003236000
  • symbol?:
  • description?: putative DoxX family membrane protein

      descriptions from strain specific annotations:

    • putative DoxX family membrane protein
    • YfiD like protein
    • doxX family protein
  • strand?: -
  • coordinates?: 3615665..3616122
  • synteny block?: BlockID0023200
  • occurrence?: in 75% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0991
    08BA02176:
    11819-97:
    MS7_0994
    71193:
    ECT-R 2:
    ECTR2_892
    ED133:
    SAOV_0982c
    ED98:
    SAAV_1000
    HO 5096 0412:
    SAEMRSA15_08680
    JH1:
    SaurJH1_1118
    JH9:
    SaurJH9_1096
    JKD6008:
    SAA6008_00991
    JKD6159:
    LGA251:
    SARLGA251_09510
    M013:
    M013TW_0966
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0972
    Mu3:
    SAHV_1030
    Mu50:
    SAV1037
    MW2:
    MW0920
    RF122:
    SAB0903c
    ST398:
    T0131:
    SAT0131_01071
    TCH60:
    TW20:
    SATW20_10330
    USA300_TCH1516:
    VC40:
    SAVC_04350

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------MKLGMLLIRWMLATSFLVHGTLKFVDLDGTIHFLGSLGLPPTIAVLMSIGEVV
    N315            -------MKLGMLLIRWMLATSFLVHGTLKFVDLDGTIHFLGSLGLPPTIAVLMSIGEVV
    NCTC8325        -------MKLGMLLIRWMLATSFLVHGTLKFVDLDGTIHFLGSLGLPPTIAVLMSIGEVV
    Newman          MNVGGDMMKLGMLLIRWMLATSFLVHGTLKFVDLDGTIHFLGSLGLPPTIAVLMSIGEVV
    USA300_FPR3757  -------MKLGMLLIRWMLATSFLVHGTLKFVDLDGTIHFLGSLGLPPTIAVLMSIGEVV
                           *****************************************************

    COL             GGLALIIGFLTPYVNVFYICVMLGSIFTLKLTRGYVSGYEFEIIHIVMNLACISSYSWKK
    N315            GGLALIIGFLTPYVNVFYICVMLGSIFTLKLTRGYVSGYEFEIIHIVMNLACISSYSWKK
    NCTC8325        GGLALIIGFLTPYVNVFYICVMLGSIFTLKLTRGYVSGYEFEIIHIVMNLACISSYSWKK
    Newman          GGLALIIGFLTPYVNVFYICVMLGSIFTLKLTRGYVSGYEFEIIHIVMNLACISSYSWKK
    USA300_FPR3757  GGLALIIGFLTPYVNVFYICVMLGSIFTLKLTRGYVSGYEFEIIHIVMNLACISSYSWKK
                    ************************************************************

    COL             WLQFY
    N315            WLQFY
    NCTC8325        WLQFY
    Newman          WLQFY
    USA300_FPR3757  WLQFY
                    *****