From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003237000
  • symbol?:
  • description?: ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • ABC transporter substrate-binding protein
    • iron compound ABC transporter iron compound-binding protein
    • putative ferrichrome ABC transporter
    • periplasmic binding protein
    • transport system extracellular bindinglipoprotein
    • ferrichrome ABC transporter
    • ferrichrome ABC transporter subunit
    • Heme ABC type transporter HtsABC, heme-binding protein
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, binding protein
    • iron (Fe3+) ABC transporter binding protein
    • iron(III) dicitrate-binding protein
    • iron compound ABC transporter, iron compound-binding protein
    • iron transport protein
    • periplasmic binding family protein
    • pseudogene
  • strand?: +
  • coordinates?: 3616952..3617929
  • synteny block?: BlockID0023210
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0992
    08BA02176:
    C248_1062
    11819-97:
    MS7_0995
    71193:
    ST398NM01_1035
    ECT-R 2:
    ECTR2_893
    ED133:
    SAOV_0983
    ED98:
    SAAV_1001
    HO 5096 0412:
    SAEMRSA15_08690
    JH1:
    SaurJH1_1119
    JH9:
    SaurJH9_1097
    JKD6008:
    SAA6008_00992
    JKD6159:
    SAA6159_00894
    LGA251:
    SARLGA251_09520
    M013:
    M013TW_0967
    MRSA252:
    SAR1011
    MSHR1132:
    MSSA476:
    SAS0973
    Mu3:
    SAHV_1031
    Mu50:
    SAV1038
    MW2:
    MW0921
    RF122:
    SAB0905
    ST398:
    SAPIG1035
    T0131:
    SAT0131_01072
    TCH60:
    HMPREF0772_12197
    TW20:
    SATW20_10340
    USA300_TCH1516:
    USA300HOU_0985
    VC40:
    SAVC_04355

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNRNIVKLVVFMLILVVAVAGCGQKDTEEKTEMTTIKDELGTEKIKKNPKRVVVLEYSFA
    N315            MNRNIVKLVVFMLILVVAVAGCGQKDTEEKTEMTTIKDELGTEKIKKNPKRVVVLEYSFA
    NCTC8325        --------------------------------MTTIKDELGTEKIKKNPKRVVVLEYSFA
    Newman          MNRNIVKLVVFMLILVVAVAGCGQKDTEEKTEMTTIKDELGTEKIKKNPKRVVVLEYSFA
    USA300_FPR3757  --------------------------------MTTIKDELGTEKIKKNPKRVVVLEYSFA
                                                    ****************************

    COL             DYLAALDMKPVGIADDGSTKNITKSVRDKIGAYESVGSRPQPNMEVISKLKPDLIIADVS
    N315            DYLAALDMKPVGIADDGSTKNITKSVRDKIGAYESVGSRPQPNMEVISKLKPDLIIADVS
    NCTC8325        DYLAALDMKPVGIADDGSTKNITKSVRDKIGAYESVGSRPQPNMEVISKLKPDLIIADVS
    Newman          DYLAALDMKPVGIADDGSTKNITKSVRDKIGAYESVGSRPQPNMEVISKLKPDLIIADVS
    USA300_FPR3757  DYLAALDMKPVGIADDGSTKNITKSVRDKIGAYESVGSRPQPNMEVISKLKPDLIIADVS
                    ************************************************************

    COL             RHKKIKSELSKIAPTIMLVSGTGDYNANIEAFKTVAKAVGKEKEGEKRLEKHDKILAEIR
    N315            RHKKIKSELSKIAPTIMLVSGTGDYNANIEAFKTVAKAVGKEKEGEKRLEKHDKILAEIR
    NCTC8325        RHKKIKSELSKIAPTIMLVSGTGDYNANIEAFKTVAKAVGKEKEGEKRLEKHDKILAEIR
    Newman          RHKKIKSELSKIAPTIMLVSGTGDYNANIEAFKTVAKAVGKEKEGEKRLEKHDKILAEIR
    USA300_FPR3757  RHKKIKSELSKIAPTIMLVSGTGDYNANIEAFKTVAKAVGKEKEGEKRLEKHDKILAEIR
                    ************************************************************

    COL             KKIEQSTLKSAFAFGISRAGMFINNEDTFMGQFLIKMGIQPEVTKDKTTHVGERKGGPYI
    N315            KKIEQSTLKSAFAFGISRAGMFINNEDTFMGQFLIKMGIQPEVTKDKTTHVGERKGGPYI
    NCTC8325        KKIEQSTLKSAFAFGISRAGMFINNEDTFMGQFLIKMGIQPEVTKDKTTHVGERKGGPYI
    Newman          KKIEQSTLKSAFAFGISRAGMFINNEDTFMGQFLIKMGIQPEVTKDKTTHVGERKGGPYI
    USA300_FPR3757  KKIEQSTLKSAFAFGISRAGMFINNEDTFMGQFLIKMGIQPEVTKDKTTHVGERKGGPYI
                    ************************************************************

    COL             YLNNEELANINPKVMILATDGKTDKNRTKFIDPAVWKSLKAVKDNKVYDVDRNKWLKSRG
    N315            YLNNEELANINPKVMILATDGKTDKNRTKFIDPAVWKSLKAVKDNKVYDVDRNKWLKSRG
    NCTC8325        YLNNEELANINPKVMILATDGKTDKNRTKFIDPAVWKSLKAVKDNKVYDVDRNKWLKSRG
    Newman          YLNNEELANINPKVMILATDGKTDKNRTKFIDPAVWKSLKAVKDNKVYDVDRNKWLKSRG
    USA300_FPR3757  YLNNEELANINPKVMILATDGKTDKNRTKFIDPAVWKSLKAVKDNKVYDVDRNKWLKSRG
                    ************************************************************

    COL             IIASESMAEDLEKIAEKAK
    N315            IIASESMAEDLEKIAEKAK
    NCTC8325        IIASESMAEDLEKIAEKAK
    Newman          IIASESMAEDLEKIAEKAK
    USA300_FPR3757  IIASESMAEDLEKIAEKAK
                    *******************