From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003240000
  • symbol?:
  • description?: membrane spanning protein

      descriptions from strain specific annotations:

    • membrane spanning protein
    • putative TM2 domain-containing protein
    • TM2 domain-containing protein
    • TM2 domain containing protein+B7201
  • strand?: -
  • coordinates?: 3618181..3618396
  • synteny block?: BlockID0023240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0994
    08BA02176:
    C248_1064
    11819-97:
    MS7_0997
    71193:
    ST398NM01_1037
    ECT-R 2:
    ECTR2_895
    ED133:
    SAOV_0985c
    ED98:
    SAAV_1003
    HO 5096 0412:
    SAEMRSA15_08710
    JH1:
    SaurJH1_1121
    JH9:
    SaurJH9_1098
    JKD6008:
    SAA6008_00994
    JKD6159:
    SAA6159_00896
    LGA251:
    SARLGA251_09540
    M013:
    M013TW_0969
    MRSA252:
    SAR1013
    MSHR1132:
    SAMSHR1132_08870
    MSSA476:
    SAS0975
    Mu3:
    SAHV_1032
    Mu50:
    SAV1039
    MW2:
    MW0923
    RF122:
    SAB0906c
    ST398:
    SAPIG1037
    T0131:
    SAT0131_01074
    TCH60:
    HMPREF0772_12196
    TW20:
    SATW20_10360
    USA300_TCH1516:
    USA300HOU_0987
    VC40:
    SAVC_04365

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKILKLEILVFTTNLSRIIVKEDLQMKVNKAIYVIVALFLGGLGIHKFYADKFGQGLFHL
    N315            -------------------------MKVNKAIYVIVALFLGGLGIHKFYADKFGQGLFHL
    NCTC8325        MKILKLEILVFTTNLSRIIVKEDLQMKVNKAIYVIVALFLGGLGIHKFYADKFGQGLFHL
    Newman          MKILKLEILVFTTNLSRIIVKEDLQMKVNKAIYVIVALFLGGLGIHKFYADKFGQGLFHL
    USA300_FPR3757  MKILKLEILVFTTNLSRIIVKEDLQMKVNKAIYVIVALFLGGLGIHKFYADKFGQGLFHL
                                             ***********************************

    COL             LFFWTGIPTIISIIHAIFVIFTKKADKDGYIIFPKN
    N315            LFFWTGIPTIISIIHAIFVIFTKKADKDGYIIFPKN
    NCTC8325        LFFWTGIPTIISIIHAIFVIFTKKADKDGYIIFPKN
    Newman          LFFWTGIPTIISIIHAIFVIFTKKADKDGYIIFPKN
    USA300_FPR3757  LFFWTGIPTIISIIHAIFVIFTKKADKDGYIIFPKN
                    ************************************