From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003241000
  • symbol?:
  • description?: acetyltransferase

      descriptions from strain specific annotations:

    • acetyltransferase
    • Acetyltransferase (GNAT family)
    • acetyltransferase (GNAT) family protein
    • acetyltransferase family protein
    • GNAT family acetyltransferase
  • strand?: +
  • coordinates?: 3618561..3619113
  • synteny block?: BlockID0023250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0995
    08BA02176:
    C248_1065
    11819-97:
    MS7_0998
    71193:
    ST398NM01_1038
    ECT-R 2:
    ECTR2_896
    ED133:
    SAOV_0986
    ED98:
    SAAV_1004
    HO 5096 0412:
    SAEMRSA15_08720
    JH1:
    SaurJH1_1122
    JH9:
    SaurJH9_1099
    JKD6008:
    SAA6008_00995
    JKD6159:
    SAA6159_00897
    LGA251:
    SARLGA251_09550
    M013:
    M013TW_0970
    MRSA252:
    SAR1014
    MSHR1132:
    SAMSHR1132_08880
    MSSA476:
    SAS0976
    Mu3:
    SAHV_1033
    Mu50:
    SAV1040
    MW2:
    MW0924
    RF122:
    SAB0907
    ST398:
    SAPIG1038
    T0131:
    SAT0131_01075 (glmS)
    TCH60:
    HMPREF0772_12195
    TW20:
    SATW20_10370
    USA300_TCH1516:
    USA300HOU_0988
    VC40:
    SAVC_04370

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------------MVWDDMELELVKHLPKDMVLDAIEKSCVDATYRTFYQHILVY
    N315            MIRQARPEDRFDIAKLVYMVWDDMELELVKHLPKDMVLDAIEKSCVDATYRTFYQHILVY
    NCTC8325        MIRQARPEDRFDIAKLVYMVWDDMELELVKHLPKDMVLDAIEKSCVDATYRTFYQHILVY
    Newman          MIRQARPEDRFDIAKLVYMVWDDMELELVKHLPKDMVLDAIEKSCVDATYRTFYQHILVY
    USA300_FPR3757  ------------------MVWDDMELELVKHLPKDMVLDAIEKSCVDATYRTFYQHILVY
                                      ******************************************

    COL             EVENKVAGCIISYSGENELKYEKAWELLDLPEKIKQYGTPLPVKEAKDDEYYIETIATFA
    N315            EVENKVAGCIISYSGENELKYEKAWELLDLPEEIKQYGTPLPVKEAKDDEYYIETIATFA
    NCTC8325        EVENKVAGCIISYSGENELKYEKAWELLDLPEKIKQYGTPLPVKEAKDDEYYIETIATFA
    Newman          EVENKVAGCIISYSGENELKYEKAWELLDLPEKIKQYGTPLPVKEAKDDEYYIETIATFA
    USA300_FPR3757  EVENKVAGCIISYSGENELKYEKAWELLDLPEKIKQYGTPLPVKEAKDDEYYIETIATFA
                    ********************************:***************************

    COL             AYRGRGIATKLLTSLLESNTHVKWSLNCDINNEAALKLYKKVGFISDGQIELYKHMYHHL
    N315            AYRGRGIATKLLTSLLESNTHVKWSLNCDINNEAALKLYKKVGFISDGQIELYKHMYHHL
    NCTC8325        AYRGRGIATKLLTSLLESNTHVKWSLNCDINNEAALKLYKKVGFISDGQIELYKHMYHHL
    Newman          AYRGRGIATKLLTSLLESNTHVKWSLNCDINNEAALKLYKKVGFISDGQIELYKHMYHHL
    USA300_FPR3757  AYRGRGIATKLLTSLLESNTHVKWSLNCDINNEAALKLYKKVGFISDGQIELYKHMYHHL
                    ************************************************************

    COL             IVK
    N315            IVK
    NCTC8325        IVK
    Newman          IVK
    USA300_FPR3757  IVK
                    ***