From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003242000
  • symbol?: menA
  • description?: 1,4-dihydroxy-2-naphthoate octaprenyltransferase

      descriptions from strain specific annotations:

    • 1,4-dihydroxy-2-naphthoate octaprenyltransferase
    • ubiA prenyltransferase family protein
    • 1,4-dihydroxy-2-naphthoate polyprenyltransferase
    • 1,4-Dihydroxy-2-naphtoate prenyltransferase
    • DHNA-octaprenyltransferase
  • strand?: -
  • coordinates?: 3619168..3620106
  • synteny block?: BlockID0023260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1049 (menA)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0996
    08BA02176:
    C248_1066
    11819-97:
    MS7_0999
    71193:
    ST398NM01_1039
    ECT-R 2:
    ECTR2_897 (menA)
    ED133:
    SAOV_0987c
    ED98:
    SAAV_1005 (menA)
    HO 5096 0412:
    SAEMRSA15_08730
    JH1:
    SaurJH1_1123
    JH9:
    SaurJH9_1100
    JKD6008:
    SAA6008_00996 (menA)
    JKD6159:
    SAA6159_00898 (menA)
    LGA251:
    SARLGA251_09560
    M013:
    M013TW_0971
    MRSA252:
    SAR1015
    MSHR1132:
    SAMSHR1132_08900
    MSSA476:
    SAS0977
    Mu3:
    SAHV_1034
    Mu50:
    SAV1041
    MW2:
    MW0925
    RF122:
    SAB0908c
    ST398:
    SAPIG1039 (menA)
    T0131:
    SAT0131_01076
    TCH60:
    HMPREF0772_12194 (menA)
    TW20:
    SATW20_10380
    USA300_TCH1516:
    USA300HOU_0989 (menA)
    VC40:
    SAVC_04375

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNQYQQYSTVKKYWHLMRPHTLTASVVPVLVGTAASKIYFLGSEDHIKISLFIAMLLAC
    N315            MSNQYQQYSTVKKYWHLMRPHTLTASVVPVLVGTAASKIYFLGSEDHIKISLFIAMLLAC
    NCTC8325        MSNQYQQYSTVKKYWHLMRPHTLTASVVPVLVGTAASKIYFLGSEDHIKISLFIAMLLAC
    Newman          MSNQYQQYSTVKKYWHLMRPHTLTASVVPVLVGTAASKIYFLGSEDHIKISLFIAMLLAC
    USA300_FPR3757  MSNQYQQYSTVKKYWHLMRPHTLTASVVPVLVGTAASKIYFLGSEDHIKISLFIAMLLAC
                    ************************************************************

    COL             LLIQAATNMFNEYYDYKKGLDDHESVGIGGAIVRNGMSPELVLRLAIAFYILAAILGLFL
    N315            LLIQAATNMFNEYYDYKKGLDDHESVGIGGAIVRNGMSPELVLRLAIAFYILAAILGLFL
    NCTC8325        LLIQAATNMFNEYYDYKKGLDDHESVGIGGAIVRNGMSPELVLRLAIAFYILAAILGLFL
    Newman          LLIQAATNMFNEYYDYKKGLDDHESVGIGGAIVRNGMSPELVLRLAIAFYILAAILGLFL
    USA300_FPR3757  LLIQAATNMFNEYYDYKKGLDDHESVGIGGAIVRNGMSPELVLRLAIAFYILAAILGLFL
                    ************************************************************

    COL             AANSSFWLLPVGLVCMAVGYLYTGGPFPISWTPFGELFSGVFMGMFIIVIAFFIQTGNIQ
    N315            AANSSFWLLPVGLVCMAVGYLYTGGPFPISWTPFGELFSGVFMGMFIIVIAFFIQTGNIQ
    NCTC8325        AANSSFWLLPVGLVCMAVGYLYTGGPFPISWTPFGELFSGVFMGMFIIVIAFFIQTGNIQ
    Newman          AANSSFWLLPVGLVCMAVGYLYTGGPFPISWTPFGELFSGVFMGMFIIVIAFFIQTGNIQ
    USA300_FPR3757  AANSSFWLLPVGLVCMAVGYLYTGGPFPISWTPFGELFSGVFMGMFIIVIAFFIQTGNIQ
                    ************************************************************

    COL             SYVIWLSVPIVITIGLINMANNIRDRVKDKASGRKTLPILLGKNASLTFMAIMYFIAYAF
    N315            SYVIWLSVPIVITIGLINMANNIRDRVKDKASGRKTLPILLGKNASLTFMAIMYFIAYAF
    NCTC8325        SYVIWLSVPIVITIGLINMANNIRDRVKDKASGRKTLPILLGKNASLTFMAIMYFIAYAF
    Newman          SYVIWLSVPIVITIGLINMANNIRDRVKDKASGRKTLPILLGKNASLTFMAIMYFIAYAF
    USA300_FPR3757  SYVIWLSVPIVITIGLINMANNIRDRVKDKASGRKTLPILLGKNASLTFMAIMYFIAYAF
                    ************************************************************

    COL             IVLTIIIKPGGSLFYLLALLSFPMPVKVIRRFKKNDTPPTMMPAMAAAGKTNTFFGLLYA
    N315            IVLTIIIKPGGSLFYLLALLSFPMPVKVIRRFKKNDTPPTMMPAMAAAGKTNTFFGLLYA
    NCTC8325        IVLTIIIKPGGSLFYLLALLSFPMPVKVIRRFKKNDTPPTMMPAMAAAGKTNTFFGLLYA
    Newman          IVLTIIIKPGGSLFYLLALLSFPMPVKVIRRFKKNDTPPTMMPAMAAAGKTNTFFGLLYA
    USA300_FPR3757  IVLTIIIKPGGSLFYLLALLSFPMPVKVIRRFKKNDTPPTMMPAMAAAGKTNTFFGLLYA
                    ************************************************************

    COL             LGIYISALFAGI
    N315            LGIYISALFAGI
    NCTC8325        LGIYISALFAGI
    Newman          LGIYISALFAGI
    USA300_FPR3757  LGIYISALFAGI
                    ************