From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003247000
  • symbol?: menH
  • description?: 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase

      descriptions from strain specific annotations:

    • 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase
    • alpha/beta fold family hydrolase
    • acyl-CoA thioester hydrolase
    • alpha/beta hydrolase
    • alpha/beta hydrolase fold family protein
    • hydrolase, alpha/beta hydrolase fold family
    • Menaquinone biosynthesis related protein
    • prolyl aminopeptidase
    • putative hydrolase
    • S33 family peptidase
  • strand?: +
  • coordinates?: 3623296..3624099
  • synteny block?: BlockID0023310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0999
    08BA02176:
    C248_1069
    11819-97:
    MS7_1002 (menH)
    71193:
    ST398NM01_1042
    ECT-R 2:
    ECTR2_900
    ED133:
    SAOV_0990
    ED98:
    SAAV_1008
    HO 5096 0412:
    SAEMRSA15_08760
    JH1:
    SaurJH1_1126
    JH9:
    SaurJH9_1103
    JKD6008:
    SAA6008_00999 (yfbB)
    JKD6159:
    SAA6159_00901 (yfbB)
    LGA251:
    SARLGA251_09590
    M013:
    M013TW_0974
    MRSA252:
    SAR1018
    MSHR1132:
    SAMSHR1132_08930
    MSSA476:
    SAS0980
    Mu3:
    SAHV_1037
    Mu50:
    SAV1044
    MW2:
    MW0928
    RF122:
    SAB0911
    ST398:
    SAPIG1042
    T0131:
    SAT0131_01079 (mtlF)
    TCH60:
    HMPREF0772_12190 (menH)
    TW20:
    SATW20_10410
    USA300_TCH1516:
    USA300HOU_0992
    VC40:
    SAVC_04390

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTHYKFYEANVETNQVLVFLHGFLSDSRTYHNHIEKFTDNYHVITIDLPGHGEDQSSMDE
    N315            MTHYKYYEANVETNQVLVLLHGFLSDSRTYYNHIDKYTDICHVITIDLPGHGEDQSSMDE
    NCTC8325        MTHYKFYEANVETNQVLVFLHGFLSDSRTYHNHIEKFTDNYHVITIDLPGHGEDQSSMDE
    Newman          MTHYKFYEANVETNQVLVFLHGFLSDSRTYHNHIEKFTDNYHVITIDLPGHGEDQSSMDE
    USA300_FPR3757  MTHYKFYEANVETNQVLVFLHGFLSDSRTYHNHIEKFTDNYHVITIDLPGHGEDQSSMDE
                    *****:************:***********:***:*:**  *******************

    COL             TWNFDYITTLLDRILDKYKDKSITLFGYSMGGRVALYYAINGHIPISNLILESTSPGIKE
    N315            TWNFDYITTLLDRILDKYKDKSITLFGYSMGGRVALYYAINGHIPISNLILESTSPGIKE
    NCTC8325        TWNFDYITTLLDRILDKYKDKSITLFGYSMGGRVALYYAINGHIPISNLILESTSPGIKE
    Newman          TWNFDYITTLLDRILDKYKDKSITLFGYSMGGRVALYYAINGHIPISNLILESTSPGIKE
    USA300_FPR3757  TWNFDYITTLLDRILDKYKDKSITLFGYSMGGRVALYYAINGHIPISNLILESTSPGIKE
                    ************************************************************

    COL             EANQLERRLVDDARAKVLDIAGIELFVNDWEKLPLFQSQLELPVEIQHQIRQQRLSQSPH
    N315            EANQLERRLVDDARAKVLDIAGIELFVNDWEKLPLFQSQLELPVEIQHQIRLQRLSQSPQ
    NCTC8325        EANQLERRLVDDARAKVLDIAGIELFVNDWEKLPLFQSQLELPVEIQHQIRQQRLSQSPH
    Newman          EANQLERRLVDDARAKVLDIAGIELFVNDWEKLPLFQSQLELPVEIQHQIRQQRLSQSPH
    USA300_FPR3757  EANQLERRLVDDARAKVLDIAGIELFVNDWEKLPLFQSQLELPVEIQHQIRQQRLSQSPH
                    *************************************************** *******:

    COL             KMAKALRDYGTGQMPNLWPRLKEIKVPTLILAGEYDEKFVQIAKKMANLIPNSKCKLISA
    N315            KMAKALRDYGTGQMPNLWPRLKEIKVPTLILAGEYDEKFVQIAKKMANLIPNSKCKLISA
    NCTC8325        KMAKALRDYGTGQMPNLWPRLKEIKVPTLILAGEYDEKFVQIAKKMANLIPNSKCKLISA
    Newman          KMAKALRDYGTGQMPNLWPRLKEIKVPTLILAGEYDEKFVQIAKKMANLIPNSKCKLISA
    USA300_FPR3757  KMAKALRDYGTGQMPNLWPRLKEIKVPTLILAGEYDEKFVQIAKKMANLIPNSKCKLISA
                    ************************************************************

    COL             TGHTIHVEDSDEFDTMILGFLKEEQND
    N315            TGHTIHVEDSDEFDTMILGFLKEEQND
    NCTC8325        TGHTIHVEDSDEFDTMILGFLKEEQND
    Newman          TGHTIHVEDSDEFDTMILGFLKEEQND
    USA300_FPR3757  TGHTIHVEDSDEFDTMILGFLKEEQND
                    ***************************