From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003250000
  • symbol?: sspB
  • description?: staphopain B

      descriptions from strain specific annotations:

    • staphopain B
    • cysteine protease
    • cysteine protease precursor SspB
    • cysteine protease precursor
    • Cysteine protease SspB
    • C47 family staphopain B
    • glycoside hydrolase family protein
    • staphopain
    • staphopain B (Staphylopain B) (Staphylococcalcysteine proteinase B)
    • Staphopain B precursor
    • staphopain peptidase C47 family protein
  • strand?: -
  • coordinates?: 3626087..3627226
  • synteny block?: BlockID0023340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1056 (sspB1)
    N315:
    SA0900 (sspB)
    NCTC8325:
    Newman:
    NWMN_0917 (sspB)
    USA300_FPR3757:
    04-02981:
    SA2981_1002 (sspB)
    08BA02176:
    C248_1072 (sspB)
    11819-97:
    MS7_1005 (sspB)
    71193:
    ST398NM01_1045
    ECT-R 2:
    ECTR2_903
    ED133:
    SAOV_0993c
    ED98:
    SAAV_1011 (sspB1)
    HO 5096 0412:
    SAEMRSA15_08790 (sspB)
    JH1:
    SaurJH1_1129
    JH9:
    SaurJH9_1106
    JKD6008:
    SAA6008_01002 (sspB)
    JKD6159:
    SAA6159_00904 (sspB)
    LGA251:
    SARLGA251_09620 (sspB)
    M013:
    M013TW_0977
    MRSA252:
    SAR1021 (sspB)
    MSHR1132:
    SAMSHR1132_08960
    MSSA476:
    SAS0983
    Mu3:
    SAHV_1040 (sspB)
    Mu50:
    SAV1047 (sspB)
    MW2:
    MW0931 (sspB)
    RF122:
    SAB0914c (sspB)
    ST398:
    SAPIG1045
    T0131:
    SAT0131_01082
    TCH60:
    HMPREF0772_12187 (sspB2)
    TW20:
    SATW20_10440 (sspB)
    USA300_TCH1516:
    USA300HOU_0995 (sspB)
    VC40:
    SAVC_04405

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNSSCKSRVFNIISIIMVSMLILSLGAFANNNKAKADSHSKQLEINVKSDKVPQKVKDLA
    N315            MNSSYKSRVFNIISIIMVSMLILSLGAFANNNKAKADSHSKQLEINVKSDKVPQKVKDLA
    NCTC8325        MNSSCKSRVFNIISIIMVSMLILSLGAFANNNKAKADSHSKQLEINVKSDKVPQKVKDLA
    Newman          MNSSCKSRVFNIISIIMVSMLILSLGAFANNNKAKADSHSKQLEINVKSDKVPQKVKDLA
    USA300_FPR3757  MNSSCKSRVFNIISIIMVSMLILSLGAFANNNKAKADSHSKQLEINVKSDKVPQKVKDLA
                    **** *******************************************************

    COL             QQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPK
    N315            QQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPK
    NCTC8325        QQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPK
    Newman          QQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPK
    USA300_FPR3757  QQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPK
                    ************************************************************

    COL             NKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATP
    N315            NKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATP
    NCTC8325        NKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATP
    Newman          NKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATP
    USA300_FPR3757  NKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATP
                    ************************************************************

    COL             LPGNVKEKESAKTVSAKLKQELKNTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDN
    N315            LPGNVKEKESAKTVSAKLKQELKNTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDN
    NCTC8325        LPGNVKEKESAKTVSAKLKQELKNTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDN
    Newman          LPGNVKEKESAKTVSAKLKQELKNTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDN
    USA300_FPR3757  LPGNVKEKESAKTVSAKLKQELKNTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDN
                    ************************************************************

    COL             SWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDI
    N315            SWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDI
    NCTC8325        SWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDI
    Newman          SWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDI
    USA300_FPR3757  SWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDI
                    ******************************************:*****************

    COL             HYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWN
    N315            HYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWN
    NCTC8325        HYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWN
    Newman          HYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWN
    USA300_FPR3757  HYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWN
                    ************************************************************

    COL             PWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
    N315            PWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
    NCTC8325        PWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
    Newman          PWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
    USA300_FPR3757  PWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
                    *********************************