From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003266000
  • symbol?: fmtA
  • description?: protein FmtA

      descriptions from strain specific annotations:

    • protein FmtA
    • fmt protein
    • FmtA, autolysis and methicillin resistant-related protein
    • methicillin resistance protein FmtA
    • autolysis and methicillin resistant-related protein FmtA
    • Autolysis and methicillin resistant-related protein
    • affects cell wall cross-linking and amidation
    • beta-lactamase
    • beta-lactamase family protein
    • carboxypeptidase
    • FmtA protein involved in methicillin resistance
    • S12 family carboxypeptidase
  • strand?: +
  • coordinates?: 3642915..3644108
  • synteny block?: BlockID0023500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0909 (fmtA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1011 (fmtA)
    08BA02176:
    C248_1082 (fmt)
    11819-97:
    MS7_1014 (fmtA)
    71193:
    ST398NM01_1054
    ECT-R 2:
    ECTR2_912
    ED133:
    SAOV_1003
    ED98:
    SAAV_1021
    HO 5096 0412:
    SAEMRSA15_08880 (fmt)
    JH1:
    SaurJH1_1139
    JH9:
    SaurJH9_1116
    JKD6008:
    SAA6008_01012
    JKD6159:
    SAA6159_00913
    LGA251:
    SARLGA251_09710 (fmt)
    M013:
    M013TW_0988
    MRSA252:
    SAR1030 (fmt)
    MSHR1132:
    SAMSHR1132_09050
    MSSA476:
    SAS0992
    Mu3:
    SAHV_1049 (fmt)
    Mu50:
    SAV1057 (fmt)
    MW2:
    MW0940 (fmt)
    RF122:
    SAB0923 (fmt)
    ST398:
    SAPIG1054
    T0131:
    SAT0131_01092
    TCH60:
    HMPREF0772_12177 (fmt2)
    TW20:
    SATW20_10530 (fmt)
    USA300_TCH1516:
    USA300HOU_1001 (fmt1)
    VC40:
    SAVC_04450

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFNKVKLVIHACVLLFIIISIALIFHRLQTKTHSIDPIHKETKLSDNEKYLVDRNKEKV
    N315            MKFNKVKLVIHACVLLFIIISIALIFHRLQTKTHSIDPIHKETKLSDNEKYLVDRNKEKV
    NCTC8325        MKFNKVKLVIHACVLLFIIISIALIFHRLQTKTHSIDPIHKETKLSDNEKYLVDRNKEKV
    Newman          MKFNKVKLVIHACVLLFIIISIALIFHRLQTKTHSIDPIHKETKLSDNEKYLVDRNKEKV
    USA300_FPR3757  MKFNKVKLVIHACVLLFIIISIALIFHRLQTKTHSIDPIHKETKLSDNEKYLVDRNKEKV
                    ************************************************************

    COL             APSKLKEVYNSKDPKYKKIDKYLQSSLFNGSVAIYENGKLKMSKGYGYQDFEKGIKNTPN
    N315            APSKLKEVYNSKDPKYKKIDKYLQSSLFNGSVAIYENGKLKMSKGYGYQDFEKGIKNTPN
    NCTC8325        APSKLKEVYNSKDPKYKKIDKYLQSSLFNGSVAIYENGKLKMSKGYGYQDFEKGIKNTPN
    Newman          APSKLKEVYNSKDPKYKKIDKYLQSSLFNGSVAIYENGKLKMSKGYGYQDFEKGIKNTPN
    USA300_FPR3757  APSKLKEVYNSKDPKYKKIDKYLQSSLFNGSVAIYENGKLKMSKGYGYQDFEKGIKNTPN
                    ************************************************************

    COL             TMFLIGSAQKFSTGLLLKQLEEEHKININDPVSKYLPWFKTSKPIPLKDLMLHQSGLYKY
    N315            TMFLIGSAQKFSTGLLLKQLEEEHKININDPVSKYLPWFKTSKPIPLKDLMLHQSGLYKY
    NCTC8325        TMFLIGSAQKFSTGLLLKQLEEEHKININDPVSKYLPWFKTSKPIPLKDLMLHQSGLYKY
    Newman          TMFLIGSAQKFSTGLLLKQLEEEHKININDPVSKYLPWFKTSKPIPLKDLMLHQSGLYKY
    USA300_FPR3757  TMFLIGSAQKFSTGLLLKQLEEEHKININDPVSKYLPWFKTSKPIPLKDLMLHQSGLYKY
                    ************************************************************

    COL             KSSKDYKNLDQAVKAIQKRGIDPKKYKKHMYNDGNYLVLAKVIEEVTGKSYAENYYTKIG
    N315            KSSKDYKNLDQAVKAIQKRGIDPKKYKKHMYNDGNYLVLAKVIEEVTGKSYAENYYTKIG
    NCTC8325        KSSKDYKNLDQAVKAIQKRGIDPKKYKKHMYNDGNYLVLAKVIEEVTGKSYAENYYTKIG
    Newman          KSSKDYKNLDQAVKAIQKRGIDPKKYKKHMYNDGNYLVLAKVIEEVTGKSYAENYYTKIG
    USA300_FPR3757  KSSKDYKNLDQAVKAIQKRGIDPKKYKKHMYNDGNYLVLAKVIEEVTGKSYAENYYTKIG
                    ************************************************************

    COL             DPLKLQHTAFYDEQPFKKYLAKGYAYNSTGLSFLRPNILDQYYGAGNLYMTPTDMGKLIT
    N315            DPLKLQHTAFYDEQPFKKYLAKGYAYNSTGLSFLRPNILDQYYGAGNLYMTPTDMGKLIT
    NCTC8325        DPLKLQHTAFYDEQPFKKYLAKGYAYNSTGLSFLRPNILDQYYGAGNLYMTPTDMGKLIT
    Newman          DPLKLQHTAFYDEQPFKKYLAKGYAYNSTGLSFLRPNILDQYYGAGNLYMTPTDMGKLIT
    USA300_FPR3757  DPLKLQHTAFYDEQPFKKYLAKGYAYNSTGLSFLRPNILDQYYGAGNLYMTPTDMGKLIT
                    ************************************************************

    COL             QIQQYKLFSPKITNPLLHEFGTKKYPDEYRYGFYAKPTLNRLNGGFFGQVFTVYYNDKYV
    N315            QIQQYKLFSPKITNPLLHEFGTKQYPDEYRYGFYAKPTLNRLNGGFFGQVFTVYYNDKYV
    NCTC8325        QIQQYKLFSPKITNPLLHEFGTKKYPDEYRYGFYAKPTLNRLNGGFFGQVFTVYYNDKYV
    Newman          QIQQYKLFSPKITNPLLHEFGTKKYPDEYRYGFYAKPTLNRLNGGFFGQVFTVYYNDKYV
    USA300_FPR3757  QIQQYKLFSPKITNPLLHEFGTKKYPDEYRYGFYAKPTLNRLNGGFFGQVFTVYYNDKYV
                    ***********************:************************************

    COL             VVLALNVKGNNEVRIKHIYNDILKQNKPYNTKGVIVQ
    N315            VVLALNVKGNNEVRIKHIYNDILKQNKPYNTKGVIVQ
    NCTC8325        VVLALNVKGNNEVRIKHIYNDILKQNKPYNTKGVIVQ
    Newman          VVLALNVKGNNEVRIKHIYNDILKQNKPYNTKGVIVQ
    USA300_FPR3757  VVLALNVKGNNEVRIKHIYNDILKQNKPYNTKGVIVQ
                    *************************************